KEGG   Methylobacterium nodulans: Mnod_1699Help
Entry
Mnod_1699         CDS       T00839                                 

Definition
(GenBank) Glutathione S-transferase domain protein
Organism
mno  Methylobacterium nodulans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACL56689
UniProt: B8IQY7
LinkDB All DBs
Position
1790944..1791579
Genome map
AA seq 211 aa AA seqDB search
MTTDRVTLYHSPNTRSSSALLLLEELGAPYDLHVLDMRAGENRQPAYLAVNPMGKVPAIR
HGEALVTEQPAIFIYLADLFPEAGLAPPLGDPLRGPYLRWMVYYGSCFEPAVVDKARELD
AGPQAMSPYGSFEAVMGVVNDQLRRGPYLLGERFSAADVLWGMALAWTTMFKLVPETPEI
AAYIARHTERPAVARVRERDAALAAGQSAAA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggaccgcgtgacgctctaccattcgccgaacacccgctcgtcgagcgcgctc
ctgctcctggaggagctcggcgcgccctacgatctccacgtgctcgacatgagggcgggc
gagaaccggcagcccgcctatctggcggtgaacccgatgggcaaggtgccggcgatccgc
cacggcgaggccctggtcaccgagcagcccgccatcttcatctatctcgccgacctcttc
cccgaggccggcctcgccccgccgctcggcgacccgctgcgcggcccctacctgcgctgg
atggtctattacggcagctgcttcgagcccgcggtggtggacaaggcgcgcgagctcgat
gccgggccgcaggccatgtcgccctatggcagcttcgaggcggtgatgggcgtcgtgaac
gaccagctccgccgcgggccgtatctgctgggcgagcgcttcagcgccgccgacgtgctg
tggggcatggccctcgcctggaccaccatgttcaagctggtgcccgagacgcccgagatc
gccgcctatatcgcccgccacacggagcgtccggcggtggcgcgggtgcgcgagcgggac
gcggcgctcgcggccggtcagagcgcggccgcctga

DBGET integrated database retrieval system