KEGG   Methylobacterium nodulans: Mnod_2778Help
Entry
Mnod_2778         CDS       T00839                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K03599  stringent starvation protein A
Organism
mno  Methylobacterium nodulans
Brite
KEGG Orthology (KO) [BR:mno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mno03021]
    Mnod_2778
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mno02000]
    Mnod_2778
Transcription machinery [BR:mno03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Mnod_2778
Transporters [BR:mno02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mnod_2778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ACL57730
UniProt: B8IFJ5
LinkDB All DBs
Position
2859188..2859973
Genome map
AA seq 261 aa AA seqDB search
MLLYEHPLSSYAQKVKIALREKGVPFTPELPESFGTGRTDGPFAAANPRMEVPVVIDGEV
TIFESTVILEYIEERWPEPPLLPREPAARAFARLTEEVCDTQYEAVNWGFGEVLWFRRAT
GALADHLRAQAAAQTRILQAWLSDRLGAADWFGGDRFGWADAAVAPMINRSVHYGLGPAE
GSTLARWHARVRERPPVAATFAEFDAAAARMAASADLYTTGGRRREYRDHRLEWMVKSGG
IEVVLAGLRAGNIRFPWPGAP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctctacgagcacccgctctcatcctacgcgcagaaggtcaaaatcgctctgcgc
gagaagggcgtgccgttcacgcccgaattgcccgagagcttcggcacgggccgcaccgat
ggccccttcgccgcagcgaacccgcgcatggaggtgccggtcgtgatcgacggcgaggtc
acgatcttcgaatccaccgtgatcctggaatacatcgaggagcgctggcccgagccgccg
ctcctgccgcgtgagcctgcggcccgcgccttcgcgcgcctgaccgaggaggtctgcgac
acgcaatacgaggcggtgaactggggcttcggcgaggtgctctggttccgccgcgcgacc
ggcgcgctggccgatcatctgcgggcgcaggcggcggcgcagacccggatcttgcaggcg
tggttgtccgatcggctcggcgcggcggactggttcggcggggatcgcttcggctgggcg
gatgcggcggtcgcgccgatgatcaaccgctccgtgcattacggtttgggacctgcagaa
ggcagcacccttgcccgttggcacgcgcgcgtgcgcgagcggccgcccgtggcggcgacg
tttgccgagttcgacgccgcggcggctcgaatggccgcttctgccgatctctacaccacg
ggcgggcggcgtcgcgagtaccgcgatcatcggctcgaatggatggtcaagtcgggaggt
atcgaggtggtgctggccggcctgcgcgccggcaacatccgcttcccgtggcccggggcc
ccatga

DBGET integrated database retrieval system