KEGG   Methylobacterium nodulans: Mnod_3110Help
Entry
Mnod_3110         CDS       T00839                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
mno  Methylobacterium nodulans
Brite
KEGG Orthology (KO) [BR:mno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Mnod_3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ACL58044
UniProt: B8IJJ6
LinkDB All DBs
Position
complement(3207167..3208210)
Genome map
AA seq 347 aa AA seqDB search
MAEPEKQGEDWRSVGTRATDKVTADLALTRAREPGRGRTADEPTQIPAPGWKDIVWRVFW
SLPQDRVLATAGGVAFFALLAVFPGLATIVSLYGLVADPSVIYQHLSLLTGVLPSGVLDL
LASELTRITKQGAGTLSTTSVLSLLIAFWSANSGVSALFDALNVIYKEREKRTLVRFYGT
TLLFTLSSVVFALIATGMVVAMPIILNQIGLRSSADAALRLVRWPALLVVVSLGLSAIYR
YGPSRREAKWRWVTWGSSVAALLWVCASALFSWYVASFDSYNRTYGSLGAGVGFMTWIWL
SVVIVLLGAELNAEMERQTARDSTTGRPKPLGSRQAFAADTVGPSQA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccagaaaagcaaggcgaggattggcgctcagtcggcactcgggcgacggac
aaggttacggcagacctggcactcactcgtgcgcgcgagcccggccggggtcgcacagcc
gatgagccgacgcagatcccggcaccgggatggaaggacatcgtctggcgcgtgttctgg
tccttgccacaggatcgcgtgctcgccacagccggtggcgtcgccttcttcgcgctgctt
gcagtattcccgggcttggcgacgatcgtatcgctctatgggctggtcgcggatccaagc
gttatctaccagcatctcagcctgctcacaggcgtgctgccgagcggcgttctagacctt
ctcgccagtgaactgacccggattaccaaacaaggtgcgggtacgctgagcacgacttcg
gtactgagcttgctgatcgccttctggagcgcgaactcgggcgtgagtgcgctgttcgat
gctctcaatgtgatctacaaggagcgggagaagcggacgcttgtgaggttctatggaaca
acgctcctgttcactctcagtagcgtcgtttttgccctgattgcaacaggcatggtggtc
gccatgccgatcattctcaatcaaatcggcctcaggtcgtctgccgacgcggccctgcgc
cttgttcggtggcccgcccttctcgtcgtggtgagccttgggctgtcggcgatctatcgc
tacggcccgagccggcgtgaggccaagtggcgctgggtgacgtggggcagcagcgtagcc
gcactgctctgggtctgcgcctcagcgctgttttcctggtacgtcgcaagcttcgacagc
tacaatcgcacgtacggctctctgggtgctggcgtcggattcatgacctggatctggctg
tcggtagtgatcgtgttgctcggtgctgagctgaatgccgagatggagcggcagaccgcg
cgcgacagcacgacagggcgacccaagccgcttggatcgcgtcaagccttcgccgctgac
acggtaggcccgtcacaggcataa

DBGET integrated database retrieval system