KEGG   Methylobacterium nodulans: Mnod_3746Help
Entry
Mnod_3746         CDS       T00839                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
mno  Methylobacterium nodulans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N Glu_dehyd_C ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACL58652
UniProt: B8IRB2
LinkDB All DBs
Position
3856241..3857290
Genome map
AA seq 349 aa AA seqDB search
MFALRKSATAFGADLMEIDRPGRPAPGFVTIDVAAAGICGSDLHAYEWTPGYEFMAMAMP
VTLGHEFSGVVREVGEGVTGLAAGDSVTCWPTVACGACEACRSGEPQHCQNRAIIGLHCD
GGFAETVTVPARNCRPLPAGLPLDVAALAEPLAVAVNAVDVAEVQPGERVVVLGPGPIGL
GIAWIAQGRGARVLLAGLDDGVRLATARRMGIAQCVDLREESLEQATRRVFGGPADRVIE
ATGVARSVSDGLAVLRSGGVMVVAGIHSAPLALDLTHFVRSKKQLRAAHDTTARALDEAI
RLLAQHADTLAVLITHRQPLARAVEAFELARSRTAVKVMLIPATAGGAA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgctgcgcaaatcggcgactgcgttcggggccgatctcatggagatcgatcgg
ccgggccgtcccgcgcccggcttcgtgacgatcgacgtcgcggcggcagggatctgcggc
agcgatctccacgcctacgaatggacgcccggctacgagttcatggcgatggccatgccg
gtgacgctgggccatgaattctccggggtcgtgcgcgaggtcggggagggcgtcacgggc
ctcgcggccggcgattccgtcacctgttggccgacggtcgcgtgcggcgcctgcgaggcc
tgccggtccggcgagccgcagcattgccagaaccgcgccatcatcgggctgcactgcgac
ggcggcttcgccgagacggtgacggtcccggcccgcaactgccgccccctgccggcggga
cttcccctcgacgttgcagccctggccgagccgctcgcggttgccgtgaacgcggtcgac
gtggccgaggtgcagccgggcgagcgcgtcgtggtgctcggcccgggcccgatcggcctc
ggcatcgcctggatcgcgcagggccgcggcgccagagtccttctcgcgggcctcgatgat
ggtgtgcgcctcgcgacggcgcgccggatgggcatcgcgcaatgcgtcgacctgcgcgag
gagagcctggagcaggcgacccgccgggttttcggcggcccggccgaccgggtcatcgag
gcgacgggcgtggcgcgctccgtctcggatggcctcgcggtcctgcgctccggcggcgtc
atggtggtcgccggcatccattccgcccccctcgccctcgacctcacgcatttcgtgcgc
agcaagaagcagctgcgcgccgcccacgacacgacggcccgggccctcgacgaggcgatc
cggctgcttgcgcagcacgcggataccctggcggtcctcatcacccatcggcagccgctc
gcccgggcggtggaggcgttcgaactcgcgcgcagccgcacggccgtcaaggtgatgctc
atcccggccacggcgggaggggcggcatga

DBGET integrated database retrieval system