KEGG   Methylobacterium nodulans: Mnod_5573Help
Entry
Mnod_5573         CDS       T00839                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
mno  Methylobacterium nodulans
Pathway
mno00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mno00405  Phenazine biosynthesis
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01130  Biosynthesis of antibiotics
mno01230  Biosynthesis of amino acids
mno02024  Quorum sensing
Module
mno_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mnod_5573
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Mnod_5573
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mnod_5573
Enzymes [BR:mno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Mnod_5573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ACL60415
UniProt: B8IP97
LinkDB All DBs
Position
5688410..5689924
Genome map
AA seq 504 aa AA seqDB search
MLVTPSLDAAQAAYAAGQPVLLRATLVADLETPVAAFLKLKAGREGAAFLLESVEGGAVR
GRYSMIGLDPDLVWRCSGGTAERADAPDLDRFVPDDRPPLDSLRDLIAESAIPGDAALPP
MAAGLFGYLGYDMVREMERLDPPKPDPIGVPDAILVRPTVMVVFDAVRDEIAVVTPLRPV
PGQPAKAACEAALNRLERVAETLEGPLPVEAWANPTEIPAPAPVSNTTPEEFHAMVARAK
AYIAAGDIFQVVLSQRFEAPFALPAFALYRSLRRVNPAPFLCYLDFGTFQIVCSSPEILV
RVRDGKVTIRPIAGTRRRGATPEEDGALAEELLADPKERAEHLMLLDLGRNDVGRVAQIG
SVTVTDSFFLEYYSQVMHIVSNVEGRLDPRHDALGALVAGFPAGTVSGAPKVRAMQIIDE
LEREKRGPYAGCIGYFGADGQMDTCIVLRTAVVKDGRMHVQAGAGIVHDSDPASEQQECV
NKAKAQFRAAEEAVRFAAQARRGQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcacgccctcgctcgatgccgcgcaggccgcctacgcggcgggccaacccgtg
ctcctgcgcgccaccctcgtcgccgacctggaaacccccgtcgccgccttcctgaagctc
aaggccgggcgcgagggcgcggccttcctgctcgaatccgtcgagggcggcgccgtgcgc
gggcgctactcgatgatcggcctcgacccggacctcgtctggcgctgcagcggcggcacg
gccgagcgggcggatgcccccgatctcgaccgcttcgtccccgacgaccgcccgcccctc
gacagcctgcgggacctcatcgccgagagcgcgattcccggcgacgcagccctgcccccg
atggcggccggcctgttcggctatctcggctacgacatggtccgggagatggagcggctc
gatccgccgaaacccgacccgatcggcgtgcccgacgccatcctggtgcgtccgaccgtc
atggtggtgttcgacgccgtgcgcgacgagatcgcggtcgtcacgccactccgccccgtc
cccggccagccggctaaagccgcctgcgaggcggcgctgaaccgcctggagcgggtggcc
gagaccctcgaaggccccctccccgtcgaggcgtgggcgaacccgaccgagatcccggcg
cccgcgcccgtctcgaacacgacgccggaggagttccacgccatggtggcgcgggccaag
gcctacatcgcggccggcgacatcttccaggtcgtgctctcgcagcgcttcgaggccccc
ttcgctctgcccgccttcgcgctctaccgctcgctgcgccgcgtgaacccggcgcccttc
ctctgctacctcgatttcggcaccttccagatcgtctgctcctcgcccgagatcctggtg
cgggtgcgcgacggcaaggtcaccatccgccccatcgccggaacccgccgccgcggcgcc
acgcccgaggaggacggggcgctcgccgaggagttgctggccgatcccaaggagcgggcc
gagcacctgatgctgctcgatctcggtcgcaacgacgtcggccgcgtcgcgcagatcggc
agtgtcacggtgacggattccttcttcctggaatattacagccaggtcatgcacatcgtc
tcgaacgtcgaggggcggctcgacccccgccacgacgcgctcggggccctggtcgcggga
tttcccgccggcaccgtctcgggcgccccgaaggtgcgggcgatgcagatcatcgacgag
ctggagcgcgagaagcgcgggccctatgcgggctgcatcggctatttcggcgccgacggg
cagatggacacctgcatcgtgctgcgcaccgccgtggtcaaggacggccgcatgcatgtc
caggctggcgccggcatcgtccacgattccgatccggcctccgagcagcaggaatgcgtg
aacaaggcgaaagcccagttccgtgccgccgaggaggccgtgcgcttcgccgcgcaggcc
cggcgggggcagtag

DBGET integrated database retrieval system