KEGG   Methylobacterium nodulans: Mnod_5671Help
Entry
Mnod_5671         CDS       T00839                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
mno  Methylobacterium nodulans
Brite
KEGG Orthology (KO) [BR:mno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mnod_5671
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     Mnod_5671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ACL60510
UniProt: B8IQJ8
LinkDB All DBs
Position
5793717..5794748
Genome map
AA seq 343 aa AA seqDB search
MKGVILHAPHDLRIEEIAVVPPGPGQVRIRIAAGGICGSDLHYYHHGGFGAVRIRQPMAL
GHEIAGTVEEIGAGVSHLVPGLRVAVNPSQPCNACRYCHEGLRHQCLHMQFIGSAMHFPH
AQGGFRQSLTIRAEQAVPVGENVSMAEAAMAEPLAVCLHAARQAGPLLGKRVLVTGCGPI
GALCIIVARLGGAREIVVTDVAQAPLSLAQQLGATHAIDIAATPEALAPYASDKGRFDVL
FEASGNERALAGALDAIRPGGVVVQVGLGGPMTLPVNIIVTKELKLHGTFRFDAEFQLAV
DLMSRGQVDLMPLVSATLPFERAVEAFELAGDRTASMKVQLAF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgtcatcctgcacgcgccgcacgatctgcgcatcgaggagatcgcggtcgtg
ccgccggggccgggccaggtccgcattcgcatcgccgccggcggcatctgcggctcggat
ctgcactactaccatcacggcggcttcggcgcggtacggatccggcagcccatggcgctc
ggccacgagatcgccggcacggtcgaggagatcggcgcgggcgtctcgcatctggttccc
ggcctgcgcgtcgcggtcaacccgagccagccctgcaacgcctgccgctactgccacgag
ggcctgcggcatcaatgcctgcacatgcagttcatcggctccgcgatgcactttccccac
gcgcagggtggcttccggcagagtcttacgatccgggcggagcaggccgtgccggtcggc
gagaacgtcagcatggcggaagccgcgatggccgagcctttggcggtctgccttcacgcc
gcgcgccaagccggtccgctgctcggcaagcgcgtgctcgtgaccggctgcggcccgatc
ggggcgctctgcatcatcgtcgcgcggctcggcggagccagggaaatcgtcgtgacggac
gtcgcacaggctccgctgtcactcgcgcagcaactcggcgccacgcatgccatcgacatc
gccgcgacgccagaggcgctcgccccctatgcttccgacaagggtcgcttcgacgtcctg
ttcgaagcgtcgggcaacgagcgggcgctggccggagccctcgatgcgatccgcccgggc
ggcgtggtggtacaggtcgggctcggcgggccgatgacgctccccgtcaacatcatcgtc
accaaggagctgaagctgcacggcacctttcgcttcgacgccgaatttcagctcgccgtc
gatctgatgagccgcggccaggtcgatctgatgccgctcgtcagcgcgactctgccgttc
gaacgcgctgtcgaagccttcgagctcgctggcgaccgcacggcatcgatgaaggtgcaa
ctcgcgttttga

DBGET integrated database retrieval system