KEGG   Methylobacterium nodulans: Mnod_7439Help
Entry
Mnod_7439         CDS       T00839                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mno  Methylobacterium nodulans
Pathway
mno00473  D-Alanine metabolism
mno00550  Peptidoglycan biosynthesis
mno01100  Metabolic pathways
mno01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mnod_7439
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mnod_7439
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Mnod_7439
Enzymes [BR:mno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mnod_7439
Peptidoglycan biosynthesis and degradation proteins [BR:mno01011]
 Precursor biosynthesis
  Amino acid ligase
   Mnod_7439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 DUF5014
Motif
Other DBs
NCBI-ProteinID: ACL62176
UniProt: B8IN60
LinkDB All DBs
Position
complement(7527506..7528429)
Genome map
AA seq 307 aa AA seqDB search
MSKHVAVLMGGWSSEREVSLNSGRACARALEAQGFRITPIDVQRNLAAVLAEVQPDIAFN
ALHGPCGEDGTVQGLLELMAIPYTHSGVLASALAMHKDRAKVVMRSAGVPVPEGRIVNRF
EAASRHVLPPPYVLKPVAEGSSVGVVIVREGRSHPPQELAREDWSYGDEVLAETYIPGRE
LTCAVMGDTALGVIDIRPATGEWYDYDAKYAKGGSVHVLPAEIKPKIYQRVRELALTAHQ
ALGCRGVSRADLRYDDTPGGTGALVVLEVNTQPGMTETSLVPELAAHAGYSFGELVRWMV
EDASLNR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcacgtcgccgtcctgatgggcggctggtcctccgagcgggaggtgtcgctg
aattccggccgagcctgtgcccgggcgctggaggcgcagggcttccgcatcaccccgatc
gacgtgcagcggaatctcgccgccgtgctcgccgaggtgcagcccgacatcgccttcaac
gccctgcacgggccctgcggcgaggacggcaccgtgcagggcctgctcgagctgatggcg
atcccctacacccattcgggcgtgctcgcctcggcgctcgccatgcacaaggaccgggcc
aaggtggtgatgcggtccgccggcgtgccggtcccggagggccgaatcgttaaccgattc
gaggccgcaagccgccacgtcctgccgccgccctacgtcctcaaacccgtcgccgagggc
tcctccgtgggggtcgtgatcgtgcgcgaggggcgctcccacccgccccaggaactcgcc
cgggaggactggtcctacggcgacgaagtccttgcagagacttacattccgggccgcgag
ctgacctgcgcggtgatgggcgatacggcgctcggcgtgatcgacatccgccccgccacg
ggggagtggtacgactacgacgccaagtacgccaagggggggtcggtgcacgtgctgccg
gccgaaattaaaccgaaaatttaccagcgggttcgagagttggcgttaacggcgcatcaa
gcacttggctgccggggcgtgagccgtgccgatctccgctacgacgacacaccgggtggc
accggtgcgctcgtggtgctggaggtcaacacgcaacccggcatgaccgagaccagcctt
gtgccggagctcgcagcccatgccgggtatagtttcggtgaactcgtccgatggatggtg
gaggacgcttccctgaaccgctga

DBGET integrated database retrieval system