KEGG   Methylobacterium nodulans: Mnod_7452Help
Entry
Mnod_7452         CDS       T00839                                 

Definition
(GenBank) acetylornithine deacetylase (ArgE)
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
mno  Methylobacterium nodulans
Pathway
mno00220  Arginine biosynthesis
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01130  Biosynthesis of antibiotics
mno01210  2-Oxocarboxylic acid metabolism
mno01230  Biosynthesis of amino acids
Module
mno_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Mnod_7452
Enzymes [BR:mno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Mnod_7452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ACL62189
UniProt: B8IN73
LinkDB All DBs
Position
7543331..7544524
Genome map
AA seq 397 aa AA seqDB search
MIPMMKSGTRLTPLALLERLVAFDTESAKSNLSLIAFVEAYLAGWGVPFVRVPNRAGDKA
ALFATIGPMRDGGVVLSGHTDVVSPAGQDWSGDPFRLRVADGRVIGRGAVDMKGFCALCL
ALVPEMLAAELRTPIHILLSYDEETTCLGVVDVIARLGADLPRPGAVIVGEPTGLDVADA
HKSVATYVTTVHGHEAHSAKPALGANAIMAAAELVAELNRIADQMIARGDPSGRFDPPYT
TVHVGVIGGGTVRNILPKTCAFEWEFRGLPDLDLDEIPRRMAAHAETVTRERLNRFGPYG
SIETVQDASVPGLAPEPGSPAERLALRVAGRNRTISVPYATEAGRFQRAGLPTVVCGPGS
IDQAHQPDEYITLAAFEAGEIFLRGLIRECAAGWSPA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgatgatgaaatccggcacccgcctgacgccgctcgccctgctcgaacggctc
gtcgccttcgacaccgagagcgcgaagtcgaacctttcgctcatcgccttcgtggaggcg
tatctcgccggctggggcgtgcccttcgtgcgcgtgccgaaccgggccggcgacaaggcg
gcgctcttcgcgacgatcgggccgatgcgggacggcggcgtcgtgctctccggccatacc
gacgtggtctccccggccggtcaggactggtcgggcgatcccttccggctgcgggtggcg
gatggccgcgtcatcggccgcggcgccgtcgacatgaaagggttctgcgcgctctgcctc
gcgctcgtgcccgagatgctggccgcggagctcaggacgccgatccatatcctcctctcc
tacgacgaggagaccacctgcctcggggtcgtggacgtgatcgcccggctcggcgccgac
ctgccgcggcccggcgccgtgatcgtcggcgagccgaccggcctcgacgtggcggatgcg
cacaagagcgtcgccacctacgtgaccacggtccacggccacgaggcacattcggccaag
cccgcgctcggcgcgaacgccatcatggcggcagcggagctcgtggcggagctcaaccgc
atcgccgaccagatgatcgcccgaggcgatccgagcggccgcttcgatccgccctacacc
accgtgcatgtgggcgtgatcggcggcgggacggtgcgcaatatcctgccgaagacctgc
gccttcgagtgggagttccggggcctgccggatctcgacctcgacgagattccccgccgc
atggcggcccatgcggagaccgtgacgcgtgagcgcctgaaccgcttcggcccctatggc
agcatcgagacggtccaggatgcctccgtgccgggcctcgcgccggagcccggctcgccc
gccgagcgcttggcgctgcgggtcgccggccgcaaccgcaccatctcggtgccctatgcc
accgaggcgggccgcttccagcgcgccggcctgcccaccgtggtgtgcggccccggctcc
atcgatcaggcgcaccagccggacgagtacatcacgctggccgccttcgaggccggcgag
atcttcctgcgcggcctcatccgcgaatgcgcggcgggctggagcccggcctga

DBGET integrated database retrieval system