KEGG   Methylobacterium nodulans: Mnod_7546Help
Entry
Mnod_7546         CDS       T00839                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mno  Methylobacterium nodulans
Pathway
mno00500  Starch and sucrose metabolism
mno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mnod_7546
Enzymes [BR:mno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mnod_7546
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Mnod_7546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: ACL62282
UniProt: B8IPJ0
LinkDB All DBs
Position
complement(7644420..7647686)
Genome map
AA seq 1088 aa AA seqDB search
MIDRSDPQWYRDAIIYQVHVKSFFDANNDGIGDFDGLTAKLDYIRDLGVTAIWLMPFYPS
PLRDDGYDIADYKGINPSYGTMRDFRRFVREAHDRGLRVVTELVINHTSDQHPWFQRARN
APKGSKWRDFYVWSDTDDRYRDTRIIFLDTEASNWTWDPVAKAYYWHRFYSHQPDLNFDN
PRVLEAVIDVMRYWLDMGVDGLRLDAIPYLIEREHTNCENLPETHDVIKKIRAALDAGYP
DRMLLAEANQWPEETAQYFGNGDECHMAFHFPLMPRMYMAIAQEDRHPITDIMRQTPEIP
EGCQWAIFLRNHDELTLEMVTDKERDYLWSFYAADRRARINLGIRRRLAPLLENDRRKIE
LMKFLLLSMPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRADPARLFLP
TIQDPIYGFDAVNVEAHSRAQTSLLNWTRRMIAIRNNQRALGRGALRFLYPSNRKVLAWL
RELDTEKVLCVANLSRAPQAVQLDLSELRNAVPVELTGGTSFPPIGDLPYLLTLPAYGFY
WFQLAQGQAETAPRVEPPELFTLVLTGGVETLMKGRERLAFERTVAPLFIGSRRWFGAKG
SRIRSVQVTDSATLPDRTGKGSFLLPRLAVSLANGERQAYFTPLAVDEGREDEALLDHAV
ARVRRGPRMGLLYGASSSTEFALSMVDGIRRGLDLSSEEGVLQFRATTLFDPELDLDPAD
IRRLSTEQSNTSIAFGSRLMLKILRRLQPGVHPEVEVGRFLSEAAGFRNTPALLGSVEHV
APDGTRTALALLQAFVRNQGDAWTLMREYLRRDLDTIVLVPESEAPTPEEVFATHLRWAS
LLGQRTAEMHRAFAMETDDPAFAAEPFTADDLATLVADTRRQAEKAMRGVAGIGPAAAES
AREAAAEILASRNELDALITRLGQHEPLGACKIRIHGDYHLGQVLASQDDLIIVDFEGEP
SRPVDERRAKSTPLRDVAGVLRSFAYGGETVTREIVSRFAEASDRTVTTVAAWRAMITAA
FLETYGLAVRGSRAAVSDDATHDRLLRLCLLNKALYEIDYEANNRPDWIEIPARGVLSLL
DEMRKVPE
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcgcagcgatccgcaatggtaccgtgacgccatcatctaccaggtccacgtc
aaatccttcttcgacgccaacaatgacgggatcggcgacttcgacgggctgaccgccaag
ctcgactacatccgcgacctcggcgtcacggcgatctggctgatgccgttctacccatcg
ccgctgcgggacgacggctacgacatcgccgactacaagggcatcaatccgtcctacggg
acgatgcgcgacttccggcgcttcgtgcgtgaggcccacgaccggggcttgcgcgtcgtc
accgagctcgtcatcaaccacacctcggaccagcacccctggttccagcgcgcccgcaac
gcccccaagggctcgaaatggcgcgacttctacgtctggtccgacacggacgacagatac
cgcgacacccgcatcatcttcctcgatacggaagcctcgaactggacctgggacccggtc
gccaaggcgtattactggcaccgcttctactcgcaccagccggatctcaacttcgacaac
ccgcgggtgctcgaagcggtgatcgacgtgatgcgctactggctcgacatgggcgtggac
ggcctgcgcctcgacgcgatcccctacctgatcgagcgcgagcacacgaactgcgagaac
ctccccgagacgcacgacgtcatcaagaagatccgcgcggcgctcgatgccggctatccg
gaccggatgctgctcgccgaggcgaaccagtggcccgaggagacggcgcagtatttcggc
aacggggacgaatgccacatggcgttccacttcccgctgatgccgcgcatgtacatggcg
atcgcccaggaggaccggcacccgatcaccgacatcatgcggcagacaccggagatcccg
gagggctgccaatgggcgatcttcctgcgcaaccacgacgagctcacgctcgagatggtg
accgacaaggagcgcgactacctctggagcttctacgccgccgaccggcgcgcccgcatc
aatctcggcatccgccgccgtctcgcgccgctcctggagaacgatcggcgcaagatcgag
ttgatgaagttcctgctgctgtcgatgcccgggacgccggtgctctactacggcgacgag
atcgggatgggtgacaacatctatctgggcgaccgcgacggggtgcgcaccccgatgcaa
tggtcgcccgaccggaacgggggcttctcccgcgctgatcccgcgcgcctgttcctgccc
accatccaggacccgatctacggcttcgacgccgtgaacgtcgaggcccatagccgcgcc
cagacgagcctgctcaactggacccggcgcatgatcgccattcgcaacaaccagcgcgcc
ctcgggcgcggagccttacgcttcctctatccgagcaaccgcaaggtgctggcgtggctg
cgcgagctcgataccgagaaggtgctctgcgtcgccaacctgtcgcgggcgccccaggcc
gtccagctcgacctatcggagctgcgcaatgccgtgccggtggagctcaccggcggcacc
tccttcccgccgatcggcgacctgccctacctgctgacgctgccggcttacgggttctac
tggttccagctcgcccagggacaggcggagacggcgccccgggtcgagccgcccgagctc
ttcaccctcgtgctcaccggcggcgtcgagaccctgatgaagggccgcgagcggctggcc
ttcgagcgcacggtggcgccgctcttcatcggctcccgccgctggttcggcgccaagggc
tcgcgcatccgcagcgtccaggtgaccgacagcgccacgctccccgaccggacgggcaag
ggcagcttcctgctgccgcggctcgccgtgtcgctcgccaatggcgagcgccaagcctat
ttcacgccgcttgcggtcgacgagggccgcgaggacgaggcgctcctcgaccatgcggtc
gcccgggtgcggcgcggcccgcgcatgggcctcctctacggggcgtcctcctcgaccgag
ttcgcgctctcgatggtggacggcatccgccggggcctcgatctgtcctcggaggagggg
gtgctgcagttccgggcgaccacgctgttcgaccccgagctcgacctcgatccggccgat
atccgccgcctctcgaccgagcagagcaacacctcgatcgccttcggctcgcggctgatg
ctgaagatcctgcgccgcctccagccgggggtccacccggaggtcgaggtcgggcgcttc
ctcagcgaggcggcaggcttccgcaacacgccggcgctgctggggagcgtggagcacgtg
gcgccggacggcacccgcacggccctcgcgctgctccaggccttcgtgcgcaaccagggc
gatgcgtggacgctgatgcgcgaatacctgcgccgcgacctcgacacgatcgtgctcgtc
cccgagagcgaggcgcccacgcccgaagaggtcttcgccacgcatctgcgctgggcgagc
ctgctcggccagcgcaccgccgagatgcaccgcgccttcgccatggagaccgacgatccg
gccttcgcggcggagcccttcacggcggacgacctcgcgaccctcgtcgccgatacgcgg
cgtcaggccgagaaggcgatgcggggcgtcgcgggcatcgggcccgcggccgccgagagc
gcccgcgaggcggcggccgagatcctggcctcccgcaacgagctcgacgcgctgatcacc
cgcctcgggcagcacgagccgctcggcgcgtgcaagatccgcatccacggcgactaccat
ctgggccaggtgctcgcctcgcaggacgacctcatcatcgtcgatttcgagggcgagccg
tcccgcccggtcgacgagcgccgggcgaagtccacgcccttgcgcgacgtcgcgggcgtg
ctgcgctccttcgcgtatggcggcgagacggtgacccgcgagatcgtctcccgcttcgcc
gaggcgagcgaccggaccgtcacgacggtcgcggcatggcgcgccatgatcacggcggcc
ttcctcgaaacctatgggctcgcggtgcggggcagccgggccgccgtctcggacgacgcc
acccacgaccgcctgctgcgcctctgcctgctgaacaaggccctgtacgagatcgactac
gaggccaacaaccgcccggactggatcgagattcccgcccgcggcgtgctctccctcctc
gacgagatgcgaaaggtgcccgaatga

DBGET integrated database retrieval system