KEGG   Massilia sp. NR 4-1: ACZ75_05730Help
Entry
ACZ75_05730       CDS       T04026                                 

Definition
(GenBank) thioester reductase
Organism
mnr  Massilia sp. NR 4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AKU21060
UniProt: A0A0K1JVD0
LinkDB All DBs
Position
complement(1581763..1587048)
Genome map
AA seq 1761 aa AA seqDB search
MPNQSPARHYPDNFVAHLRALAAQRPDDTALIVVAERDGKALDTPLSYALLERRVRALAA
QLQRRFSSGERVLLLLDNDDHYVVSFFACMYAGLIAVPVFPPESARPQHLARLAGIAEDA
QAACILTSGAILEMVGEAMSAFGGAAVIAADSIAIGMAEEWAEREPSSGDVAFLQYTSGS
TSTPKGVMVTHGNLMANERAIEATMDVRASDVFVSWLPLYHDMGLIGGLLQPFHRGIPVG
LMTPRFFLERPVRWLQAVARLRATISGGPDFAFRLCLERVREEQIARLDLSSWRLAFSGA
EPVRYDTLRDFIAHTVPAGFSGSSVYPCYGLAEATLLLTGGRRAGGICAQGFSAASLAQG
RAQPDAGGNMLVACGAIAPDHVLEIVDPASGRVLEAGYAGEIQASGPSIASGYWRREEAS
TETFVERDGRRWLRTGDLGFLHEDQLYITGRIKDLIIVRGQNIYPQDIERGIEAEVEAAR
KGRVAAFAVATPDGGEGVGVAVEVSRGMQKLVPVKVLVDALSQAVVAACREPASVVVLLN
PGALPKTSSGKLQRGACRKRWQDGTLDTYAVYQFGAFASGGPADGGEQAPLSEAETALAA
LWREVLKRDASAAFARDAHFLASGGNSLAAVQLAARIGERWNIDFPVRQIFEQPQLGAMA
AAIARQPQGASGKAVLSPIVPLPAERRRQALPLSHAQQRQWFLWQMAPESCAYHVSGALR
YTGALDSVALHAAFDALIARHEPLRTLFQAGADGRGEQLIQVEMPLDWSEIDLRGLPENE
RQPQALQLVEELNARPFDLCHGPLLRAALLRLGDEAHILAVAMHHIVSDAVSMQVLLAEL
AAHYRAHLAGSAAPLAALPVQYADYAAWQHEWLKEGAGARQLAYWREQLGGEQPVLALPA
DRARPPVANYRAAAHRLELEPQLLKALNDGAHRAGGTLFMVLLAGFQVLLHRYTGQGDIR
VGIPIANRQRIETEGLIGFFVNTQVLRGEIHGRRSLAEVLHDVRETALAAQSHPDLPFEQ
LVDALQPERSLSHTPLFQVMFNHLRADFGTLAQLPGVDAEYLALREPAAQFELTLETTEL
ASGRLGVRFIYAAELFEAATIARMADDYLAILDALAHQSGQAVGDVALVSQQEQISLEEW
GVNPVRHADAEPVHRSFERNALRHPDAPALLFGDQTLSYAELNARANRLAHRLMALGVGL
ESRVGIAVERSLDMMIGLLAILKAGAAYVPLDTDYPAERLRYMAEDSGIGLLLTHSALSA
SLPMSAVPALLLDQIDVNAESSANPAVPVHGENLAYVIYTSGSTGNPKGAANRHRSLSSC
MAWMQETYHLTPADTVLHKAAFGFDVSVWEQFWPLTAGARLALALPGDQRDPARLVALIQ
QHQVTTVNFVPPMLQAFLAHEGIEASTRLKHIICGGEAMPAETQRETFERLRRAGLHNLY
GPTETAIHVTHWACRNDGQSLVPIGRPISETHTYVLDAELNMVPAGVAGELYLGGVGLGR
GYLHRPGLSAERFVADPFDPRGGRLYRTGDLVRWNGEGQLEYLGRIDHQLKIRGLRIELG
EVEAQLLAQPEVREAVVLARDGAGGKRLVGYVSAHEGKLADGAELKARLALRLPDYMVPQ
HIAVLPSLPLSANGKVDRKALPDVALPGRTASEAPQGQLEQALGQLWCALLELESVDRRD
SFFELGGNSLLLLQLQRRLAQQLDLHPTVVDLFKYPTLEALAAFLGSVAPSARSTAEVDE
RAKRQRGAFLQRKAVAERAPT
NT seq 5286 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcagtcgcccgcgcgccactatcccgataatttcgtcgcccatctgcgcgcg
cttgcggcgcaacgtcccgacgacaccgccttgatcgtggtggccgagcgggacggcaaa
gccctcgataccccgctttcctatgcgttgctggagcggcgcgtgcgcgcgctggcggcg
cagctgcagcgccgcttcagttccggcgagcgcgtcctgctgttgctggataacgacgat
cattatgtggtcagcttctttgcctgcatgtatgcaggactgatcgcggtgccggtgttt
ccgccggaatcggcgcggccccagcatctggcgcgcctggccggcatcgcggaggatgcg
caagcggcttgcatcctgacctccggcgcgatcctggaaatggtgggcgaggcgatgagc
gcctttggcggcgcggcggtgatcgcggccgacagcattgccatcggtatggcggaggaa
tgggccgagcgcgagccatcgagcggcgacgtcgcttttctgcagtacacctcgggttcg
acctccacgcccaagggtgtgatggtcacgcacggcaatctgatggcgaacgagcgcgcc
atcgaggcgaccatggatgtgcgggccagcgatgtcttcgtctcctggctgccgctatac
cacgatatgggcctgatcggcggcttgctgcagccattccatcgcggcatccccgtggga
ttgatgacgccccgcttcttcctggagcgcccggtacgctggctgcaggcggttgcgcgc
ctgcgcgccaccatcagcggcgggccggatttcgcgttccggctttgtcttgaacgggtc
agggaagagcagattgcacggctcgacctgtcgagctggcggctggcgttttccggcgcg
gagccggtgcgctacgacaccctgcgcgacttcattgcgcatacggtgccggccggtttt
tccggctcttccgtctatccctgctatggtctggccgaagcgacgctgctgctgaccggc
ggccgccgcgcgggcggcatatgcgcccagggcttttcggccgccagtctggcgcaaggc
cgggcgcagcccgatgccggcggcaatatgctggtggcttgcggcgcgatcgcgcccgat
catgtgctggagattgtcgatcccgcttcgggacgcgtgctggaggcgggatacgcgggc
gagattcaggccagcggtccaagcattgccagcggctattggcggcgcgaggaggccagc
accgaaacctttgtcgaacgtgatggacggcgttggctgcgcacgggcgatctcggcttc
ctgcatgaggatcagctgtatatcaccggccgcatcaaggatttgattatcgtgcgcggc
cagaatatctatccccaggatatcgagcgcggcatcgaagccgaggtggaagcggcgcgc
aagggccgcgtggccgcctttgcggtcgctacgcccgatggcggcgaaggcgtgggcgtg
gccgtcgaggtttcgcgcggcatgcaaaagctggtgccggtcaaagtgctggtggatgcc
ctgagccaggcggtcgtggcggcatgccgggagccggcatcggtcgtggtgctgctgaat
cccggcgcattgcccaagacttccagcggcaagctgcagcgcggcgcctgccgcaagcga
tggcaggatggcacgctggacacgtatgcggtgtatcagttcggcgcgttcgcgtcgggc
gggccggccgatggtggtgagcaggcgccgctgagcgaggccgagacggcgctagccgcc
ctgtggcgcgaggtgctcaagcgcgacgcgtcggcggcgtttgcgcgcgatgcccatttc
cttgccagcggcggcaattcgctggcggcggtgcaattggcggcgcgcatcggggagcgg
tggaatatcgattttccggtgcggcagatattcgagcagccgcagctcggcgcaatggcg
gcggcgatcgcccgccagccccagggcgcttccggcaaggcggtgctgtcgcctatcgtg
ccgctgcctgcggagcggcgccgccaggcgctgccactgtcgcatgcacagcaaaggcag
tggttcctgtggcagatggcaccggagagctgcgcttatcacgtcagcggcgcgctgcgc
tacaccggtgctctggactccgtggccttgcacgcagcattcgatgccctgattgcccgc
catgagccgctgcgcaccctgttccaggccggcgcggacggcaggggcgagcagttgata
caggtggaaatgccgctggactggtcggaaatcgacctgcgcggcctacccgaaaatgag
cgccagccgcaggccttgcagctggttgaagaattgaatgcgcgcccgttcgatttgtgc
cacggtccgctgctgcgcgcggcgctgctgcggcttggcgacgaggcacatattctggcg
gtggcgatgcaccatatcgtgtcggacgccgtgtcgatgcaggtgctgctggccgaactg
gccgcgcattatcgcgcccatctggcgggcagcgcagcgccattggctgcgctgccggtg
caatatgcggattacgcggcatggcagcatgagtggctgaaggagggtgccggagcgcgc
cagctggcttactggcgggagcagctgggcggcgagcagccggtgctggctctgcccgca
gaccgcgcgcggccgccggtggcgaactaccgggccgccgcccatcgcctggagctggaa
ccacagctcctgaaagcgttgaacgacggtgcccatcgcgccggcggcacgttgttcatg
gtgctgctggcgggcttccaggtgctgctgcaccgctacactggccaaggcgatatccgc
gtcggcatccccatcgccaaccgccagcgcatcgagaccgaggggctgatcggcttcttc
gtcaatacccaggtgctgcgcggcgaaatccacggccgccgcagcctggccgaagtgctg
cacgatgttcgcgaaacggcgctggcggcgcaatcgcatcccgacctgccgtttgagcag
ttggtcgatgccttgcagccggaacgcagcttgagccataccccgctgttccaggtgatg
ttcaaccatttacgcgccgacttcggcacgctggcgcaactgcccggggtggatgccgaa
tatttggccctgcgcgaaccggcggcgcagttcgaactgacattggaaaccacggagctg
gccagcgggcggttgggcgtgcgcttcatctatgcggcggaactgttcgaagcggctacc
atcgcccgtatggcggacgattatctggccattctcgacgcgttggcgcaccaaagcgga
caggcggtgggcgatgtggccctggtcagccagcaggaacagattagtctggaggagtgg
ggcgtcaatccggtgcgccatgccgacgcggagccggtgcaccggagctttgaacgcaat
gcgctgcgccatcccgatgcgccagccttgctgttcggcgatcagaccctcagctatgcg
gaactgaacgcccgcgccaaccgccttgcgcaccgcctgatggcgctgggcgtgggactg
gagagccgggtcggcattgccgtcgaacgttctctggacatgatgattggcctgctggcg
attctgaaagccggcgccgcctacgtgccgctggataccgactacccggcggaacgcctg
cgctatatggccgaggacagcggcatcggcctgctgctcacgcacagtgcactgagtgcc
agcctgcccatgtccgctgtgcctgcactgctgctggaccagatcgatgtcaatgccgag
agtagcgcgaatccggccgtgccggtgcatggcgagaacctggcttacgtgatctacacc
tccggctcgaccggcaatccgaaaggcgcggccaaccgccaccgctccctgtccagctgc
atggcgtggatgcaggagacgtaccacctgacgcccgccgataccgtgctgcacaaggcg
gctttcggtttcgacgtctcggtatgggagcagttctggcctttgacggctggcgcgcgc
ctggcgctggccttgcctggcgatcagcgcgacccggcgcgcctggtggcgctgattcag
cagcaccaggtcactacggtcaacttcgtgccgccgatgctgcaagccttcctggcgcat
gaaggaatcgaagccagcacgcggctcaagcacattatctgcggcggcgaagccatgccg
gccgagacgcagcgcgaaaccttcgagcgcctgcgccgcgccggcctgcacaatctgtac
gggccgaccgaaacggcgatccacgtgacgcattgggcctgccgcaacgacgggcaaagc
ctggtgccgatcggccgtccgatcagcgaaacccatacctatgtgctggatgcggagctg
aatatggtgccggccggggtggcgggcgagctgtatctcggcggcgtgggtctgggacgg
ggttatctgcaccgtccgggcttgagcgccgagcgcttcgtggccgatcccttcgatccg
cgcggtggccgcctgtaccgcaccggggatctggtgcgctggaatggcgaaggccagctg
gaataccttggacgcatcgatcaccaattgaagattcgcggcctgcgcatcgaactgggc
gaggtcgaggcgcaattgctggcgcagccggaagtgcgcgaggctgtggtgctggcacgc
gacggcgcgggcggcaagcgcctggtcggctatgtgtcggcgcacgagggcaagctggcg
gatggcgcggagctgaaggcgcgcctggcgctgcgcctgccggactatatggtgccgcag
catatcgcggtgctgccgtcgctgccgctgagcgcgaacggaaaggtggaccgcaaggcg
ctgccggatgtggcgctgccgggccgtactgccagcgaggcgccgcaagggcagctggaa
caggcactgggccagctctggtgcgccctgcttgaactggagagcgtggaccggcgtgac
agcttctttgagctgggcggtaattcgctcttgctgctgcaattgcagcgccgtctggcg
cagcagctggacctgcatccgacggtggtcgatctgttcaagtacccgacgctggaagca
ctggcggccttcctgggtagtgttgcgccgtcggcacgctccacggcggaagtcgatgaa
cgcgcgaaacgccagcgcggcgcatttttacaacgtaaagcagtagcggaaagagcgccg
acatga

DBGET integrated database retrieval system