KEGG   Massilia sp. NR 4-1: ACZ75_07355Help
Entry
ACZ75_07355       CDS       T04026                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00550  Peptidoglycan biosynthesis
mnr01100  Metabolic pathways
mnr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACZ75_07355
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ACZ75_07355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mnr01003]
    ACZ75_07355
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mnr01011]
    ACZ75_07355
Enzymes [BR:mnr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ACZ75_07355
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ACZ75_07355
Glycosyltransferases [BR:mnr01003]
 Polysaccharide
  Bacterial polysaccharide
   ACZ75_07355
Peptidoglycan biosynthesis and degradation proteins [BR:mnr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ACZ75_07355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AKU24748
UniProt: A0A0K1K6D1
LinkDB All DBs
Position
1998729..2001032
Genome map
AA seq 767 aa AA seqDB search
MIATAVAGALGAAAVAGYMALYIAPNLPSLEAVTDYKPKIPLRIYTADKVLIGEFGEEHR
DFVAIKDVPAMMKKALLAIEDTQFYEHGGINWKRGLGAAVANLSGGFRQGGSTITMQVAR
NFFLTRDKILSRKLNEIMLAYKIEAALSKDEILELYMNQIYLGQRSYGFSSAARTYFGKS
LKELSIAETAMLAGLPQNPARHNPAVNPKRAKQRQHQVLKRLRDLDYITEADYQKALHEP
LHVNTRGQEYDTHAEYVAELARQAVVAEYKEEAYTRGINVYTTILHADQDAAYESLRRNV
IAYDQRHGYRGPEAFIELPAEEEKRDEAIDEALARRPNMDRLIAAVVLQASPKSVKVETA
DGEEVEISGDGLKLAATALSDNAKPAIKLRPGAVIRVARNEKKAWAISQVPKVAAAFVSL
DANTGAYHALVGGFDFGQQKFNHVTQAWRQPGSAMKPFIYSAAVEKGYGPATLINDVPLE
MPGSETGGEPWRPQNDDGKFDGPISMRRSLAVSKNVASVRLLRAIGVPYAHEYIGKFGFD
GARQPKNLTMTLGTGSVTPLQMAGAYAVFANGGYRVQPYLIARITDAKGALLSETKVPAP
AQESARVLDARNVFITDSMLREVTRSGTGAAATPRVGRSDLAGKTGTTNDAVDGWFAGYG
GGIVGVAWMGYDDPKSLGGREFGATLAMPIWIDYMRVALAKRPPVERAAPEGVVQLNGDW
IYEEYMNDTTARGIDLEGEPPGEAAPETAPESPTAPPTTPAPAPAGT
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
ctgatcgccaccgctgtcgccggcgcgctgggcgcagcggcggtggccggctatatggcc
ctgtacatcgcccccaacctgccctcgctggaagcggtcaccgattacaagcccaagatc
ccgctgcgcatctacacggcggacaaagtattgatcggcgaattcggtgaagagcaccgc
gatttcgtggccatcaaagacgtgccggcaatgatgaagaaggcgctgctggccatcgag
gacacgcagttctacgagcacggcggcatcaactggaagcgcggcctcggcgccgccgtc
gccaatctgagcgggggcttccgccagggcggctccaccatcaccatgcaggtggcgcgc
aatttcttcctgacgcgggacaagatcctgtcgcgcaagctgaacgagatcatgctggcc
tataagatcgaagcggcgctgagcaaggacgagattctggagctgtacatgaaccagatc
tacctgggccagcgctcctatggcttcagcagcgcggcgcgcacctacttcggcaagtcg
ctgaaagagctgtcgattgccgagacggcgatgctggccggcctgccgcagaacccggcg
cgccataacccggccgtcaatcccaagcgcgccaaacagcgccagcaccaggtgctgaaa
cgtctgcgcgacctggattacatcaccgaagccgactatcagaaagcactgcacgagccg
ctgcacgtcaatacgcgcggccaggaatacgacacccacgcggagtatgtggccgaactg
gcgcgccaggccgtggtggccgagtacaaggaagaagcctacacgcgcggcatcaacgtc
tacactaccatcctgcacgccgaccaggacgcggcctacgaatcgctgcgccgcaacgtg
atcgcttacgaccagcgccacggctatcgcggcccggaagccttcatcgaactgccagcc
gaagaggaaaagcgcgacgaagcgatcgacgaggcccttgcccgccgtccgaatatggac
cgtctgatcgccgccgtggtgctgcaagcctcgcccaagtccgtgaaggtggaaacggcc
gacggcgaggaagtggaaatcagcggcgacggcctgaaactggccgcaacggcgctgagc
gacaacgccaagccggccatcaagctgcgcccgggcgccgtgatccgcgtcgctcgcaac
gagaaaaaagcctgggccatcagccaggtgccgaaagtggcggcggccttcgtctccctc
gacgccaataccggcgcctatcacgccctggtgggcggcttcgactttggccagcagaaa
ttcaaccacgttacccaggcctggcgccagccgggatcggcgatgaagcccttcatctat
tcggcagcggtggaaaaaggctacggccccgccacgctgatcaacgacgtgccgctggaa
atgccaggctcggaaaccggcggcgaaccatggcgtccgcaaaacgacgacggcaaattc
gatggtccgatcagcatgcgccgttcgctggccgtatccaagaacgtggcctcggtacgc
ctgctgcgcgccatcggcgtgccgtatgcccatgaatacatcggcaagttcggcttcgat
ggcgcgcgccagccgaaaaacctgaccatgaccctcggtacgggctcggtcacgccgctg
caaatggccggcgcctatgccgtcttcgccaacggcggctaccgcgtccagccctatctg
attgcgcgcattaccgacgccaagggcgcgctgctatccgaaaccaaggtcccggcgcca
gcccaggaaagcgcacgcgtgctcgatgcgcgcaatgtcttcatcaccgacagcatgctg
cgcgaagtgacgcgcagcggcaccggcgccgccgccacgccgcgcgtgggccgcagcgac
ctggccggcaagaccggcaccaccaacgatgccgtggacggctggttcgccggttatggc
ggcggcatcgtgggcgtggcctggatgggctacgacgatcctaaatcgctgggcggccgc
gaattcggcgccacgctcgccatgccgatctggatcgactatatgcgtgtggccctggcc
aagcggccgccggtggaacgcgcggcgccagagggcgtggtgcagctgaacggcgactgg
atctatgaggaatacatgaacgacaccaccgcgcgcggcatcgacctggaaggcgaaccg
cccggcgaggccgcgccggaaacggcgccggagtccccgactgcgccgcctacaacacca
gccccggctccggcggggacttga

DBGET integrated database retrieval system