KEGG   Massilia sp. NR 4-1: ACZ75_08315Help
Entry
ACZ75_08315       CDS       T04026                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ACZ75_08315 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mnr03400]
    ACZ75_08315 (ligD)
Enzymes [BR:mnr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACZ75_08315 (ligD)
DNA repair and recombination proteins [BR:mnr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ACZ75_08315 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AKU21481
UniProt: A0A0K1JWV9
LinkDB All DBs
Position
complement(2213853..2216351)
Genome map
AA seq 832 aa AA seqDB search
MKDSLKTYKAKRDFSITPEPAEGGVQGEALSFVIQKHWSSRLHYDFRLELDGAMKSWAVP
KGPSYDTHDKRMAVHVEDHPISYNDFEGTIPPKQYGAGKVIIWDKGSWHPLGDPRQGYRQ
GNLKFELRGHKMHGHWVLVRMKGRGEKQEPWLLIKENDDYARPAAEFSVVDEMPDSVKDL
GMPASTGDKAVPRAAALPTELAPQLATLVDAPPTEPEQWLFEVKYDGYRLLARVDGRKIR
LMTRNGNDWTHKLELLRAELASMKLPAGWYDGEIVVHNENGLPDFGLLQQAFDGERTESI
AYFLFDVPYLNGYDLRHLPFEQRRELLQTVLEKSRSDKVRLSAILDAQAADIVKAACSLG
LEGVIGKRRDAPYVSRRSAGWIKLKCGQRQEFVIGGYTDPRGARTGIGSLLLGYFDEGGK
LHYAGNVGSGFNESALRELKARLKRLHAADSPFAASRSIGKKAHWVKPALVAEVSFGEWT
RSGSVRHAVFQGLRSDKQASAVRRERPAHTEDIVTDKPQAKARAAQGEGGASAPLHGKLP
ASLKISNPGRVIDAASGSSKIDLVRYYALVAPLMLEHLKGRPVALVRAPAGVGGELFFQK
HAESGKLAGVKSLPQELDPEHAPMLEVATARGLLESAQWNVVEFHTQNALGRNYEKPNRM
VFDLDPGEGVAWPQMQEAAQLLHAFLDELGLQAFLKTSGGKGLHAVVPIKPYYGWDTVKA
FSKAIVEHMAQTLPERFANKSGPKNRVGKIFIDYLRNGRSATTVCAWSARSRPGLGISVP
CGWDELAALRGADQWTIHNVHTRLDQGNTPWSGYGAGARGVAPAMKALGFTP
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgaaggactccctcaagacctataaagccaagcgcgatttttccatcacgccggaaccg
gccgaaggtggcgtgcagggagaagcgctgagcttcgtcatccagaagcattggtccagc
cgcctgcattacgacttccgcctggaactggacggcgccatgaaaagctgggccgttccc
aaaggccctagctacgacacgcacgacaagcgcatggccgtgcatgttgaagaccatccg
atttcctacaacgatttcgaaggcaccatcccgcccaaacagtatggcgcgggcaaggtc
attatctgggacaagggcagctggcatccgcttggcgacccgcggcagggctaccgccag
ggtaatctgaagttcgagctgcgcggccataagatgcatgggcactgggtcctggtgcgc
atgaaggggcgcggagaaaagcaggaaccctggctgctcatcaaggaaaacgacgactat
gcgcggccggccgcggaattcagcgtggtcgatgagatgccggacagcgtcaaagacctg
ggcatgccggcgtccaccggtgacaaggcggtgccccgtgccgccgcgctgcccaccgag
cttgctccccaactggcgacgctggtggatgcgccgcccaccgagccggaacagtggctg
tttgaagtcaaatatgacggctaccgcctgctggcgcgcgtcgatggccgcaagatccgc
ctgatgacccgtaacggcaacgactggacccacaagctggagctgctgcgcgccgaactg
gcgtcgatgaaactgccggcgggctggtatgacggcgagatcgtggttcacaacgaaaac
ggcttgcccgatttcggcctgctgcagcaggctttcgatggcgaacgcacggaaagcatc
gcttacttcctgttcgacgtcccttacctgaatggctatgatttgcgccacctgccgttc
gaacagcgccgcgagctgttgcaaaccgtgctggaaaaaagccgctcggacaaggtgcgc
ctgagcgccatactcgatgcccaagccgccgatatcgtgaaggccgcctgcagcctgggg
ctggaaggcgtgatcggcaagcggcgcgatgcgccctatgtatcgcgccgttcggccggc
tggatcaagctcaaatgcgggcagcgccaggaattcgtgatcggcggctataccgatccg
cgcggcgcgcgcaccggcatcggttctctgctgctcggctatttcgacgaagggggcaag
ctgcattatgccggcaatgtgggcagcggcttcaacgaaagcgcgctgcgcgaactgaag
gccaggctgaaaaggctgcatgccgccgacagccctttcgccgccagccgcagcatcgga
aagaaagcgcactgggtcaagcccgcactggtggccgaagtcagttttggcgaatggacg
cgcagcggatcggtgcgccacgccgtattccaggggctgcgcagcgacaagcaggccagc
gccgtccggcgcgagcgtcccgcgcatacggaggatatcgtgacagacaagccgcaggcc
aaggcgagggccgcgcaaggggagggcggcgcatccgcaccgctgcacggcaagctgccc
gcatcgctcaagatcagcaatcccggacgcgtgatcgacgctgccagcggcagcagcaag
atcgacctggtgcgctactacgccctggtggcgccgctgatgctggaacatctgaaaggc
cgcccggtggccctggtgcgcgcgccggcgggcgtgggtggagagctgttcttccagaag
catgccgaaagcggcaagctggccggcgtcaaatcgctgccgcaggagctggacccggag
catgcgccgatgctggaagtcgccaccgcgcggggactgctggaatcggcgcagtggaat
gtggtcgaattccatacccagaatgcgttgggccggaactatgaaaagcccaaccgcatg
gtgttcgacctcgatcccggcgagggtgtggcatggccgcagatgcaggaagcggcgcag
ctgctgcatgccttcctcgatgaactgggcctgcaggccttcctcaaaaccagcggcggc
aagggtttgcatgcggtcgtgccgatcaagccgtattacggctgggacacggtcaaggcc
ttcagcaaggccatcgtcgagcatatggcgcagacgttgcccgagcgtttcgccaacaag
agcggaccgaaaaaccgcgtcggtaaaatcttcatcgactatctgcgcaatggccgcagc
gccaccaccgtgtgcgcctggtccgcacgcagccgtccgggactgggtatttccgtgcct
tgcggctgggacgagctggcggcattgcgtggcgccgaccagtggaccatccataacgtc
cacacgcggctggaccagggcaatacgccctggtccggatatggcgcgggcgcgcgcggc
gtcgccccggccatgaaagcgctgggctttacgccttag

DBGET integrated database retrieval system