KEGG   Massilia sp. NR 4-1: ACZ75_13025Help
Entry
ACZ75_13025       CDS       T04026                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00061  Fatty acid biosynthesis
mnr00780  Biotin metabolism
mnr01100  Metabolic pathways
mnr01130  Biosynthesis of antibiotics
mnr01212  Fatty acid metabolism
Module
mnr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ACZ75_13025
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ACZ75_13025
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ACZ75_13025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mnr01004]
    ACZ75_13025
Enzymes [BR:mnr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ACZ75_13025
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ACZ75_13025
Lipid biosynthesis proteins [BR:mnr01004]
 Fatty acid synthase
  Component type
   ACZ75_13025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AKU22248
UniProt: A0A0K1JZ43
LinkDB All DBs
Position
complement(3195207..3195983)
Genome map
AA seq 258 aa AA seqDB search
MSAAQPILEGRRALVVGVANEHSIAYGCAKVFRELGAEVALTYLNEKARPHVAPLAQELG
AALLLPLDVSQPGQLESAFAAIGERWDRLDILVHSIAFAPKEDLQGGLLHCSAEGFLQAM
DISCHSFVRMARLAAPLMTQGGAMFAMSYHGADKVVPNYNVMGPVKAALEASCRYLAYEL
GPQEIRVHAISPGPLQTRAASGLKDFDLLLSDAVARAPIGELVDIMDVGSTCAYLASPYA
RRLTGSTVYVDGGLNIIA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcccaacctattctcgaagggcggcgcgccctggtcgtgggcgtcgccaac
gagcattcgatcgcctacggctgcgccaaggtgttccgcgaactcggcgccgaagtggcg
ctgacctatctgaatgagaaggcgcggccgcatgtcgcaccgctggcgcaggaattgggc
gccgcgctgctgctgccgctcgacgtgtcccagcccggccagctggaaagcgccttcgcc
gccatcggagagcgctgggaccggctcgacatcctggtgcactcgatcgccttcgcgccc
aaagaggatttgcagggcggcctgctgcactgctcggccgaaggcttcctgcaagcgatg
gacatttcctgccattccttcgtgcgcatggcgcgcctggccgcgccgctgatgacgcaa
ggcggcgccatgttcgccatgagctatcacggcgccgacaaggtggtgcccaactataac
gtcatgggaccggtgaaggcggcgctggaagcgtcctgccgctacctggcgtatgagctg
gggccgcaggagatccgcgtgcatgcgatttcgcccggcccgctgcagacgcgcgccgcc
tccggcttgaaggacttcgacctgctgctgagcgacgccgtggcgcgcgccccgatcggc
gagctggtggatatcatggacgtgggcagcacctgcgcctatctcgcctcgccctatgcc
cggcgcctgaccggcagcaccgtgtacgtggacggcggcctcaacatcattgcctga

DBGET integrated database retrieval system