KEGG   Massilia sp. NR 4-1: ACZ75_14200Help
Entry
ACZ75_14200       CDS       T04026                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00061  Fatty acid biosynthesis
mnr00780  Biotin metabolism
mnr01100  Metabolic pathways
mnr01130  Biosynthesis of antibiotics
mnr01212  Fatty acid metabolism
Module
mnr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ACZ75_14200
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ACZ75_14200
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ACZ75_14200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mnr01004]
    ACZ75_14200
Enzymes [BR:mnr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     ACZ75_14200
Lipid biosynthesis proteins [BR:mnr01004]
 Fatty acid synthase
  Component type
   ACZ75_14200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AKU22448
UniProt: A0A0K1JZN7
LinkDB All DBs
Position
complement(3484435..3485217)
Genome map
AA seq 260 aa AA seqDB search
MSMSSPIPVYPDLQGKVALVTGGSRGIGAAACLALARSGVKVAVNGRDRDAIGATVAAIR
DQGGAAFAAPADCSSLAAVQDMRAAIEDHFGAPELLLAFAGGGSGRPLPLAEITEEDWRS
SIDHNLTSTFFTLKCFLPAMLARGHGSIVTMASAGGRMASGAPAGYGAAKAGVIMLTRHA
ANEVGRQGIRVNCISPSAVLTERTAQRMPPAQQQAMLAAFPLGRLGQPDDIAAAALFLLS
ASSSWITGITLDIAGGRVMN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgagcagcccgattcctgtctatcccgacctgcaaggcaaggtcgctctcgtt
accggcggatcgcgcggcatcggcgcggcggcctgtctggcgctggcgcgcagcggcgtg
aaagtcgccgtcaatggccgcgaccgcgatgccatcggcgccacggtggcggccatccgc
gaccagggcggcgcggctttcgcggcgccggccgactgttccagcctggccgccgtgcag
gatatgcgcgccgccatcgaggaccattttggcgcgcctgaactgttgctggccttcgcc
ggcggcggcagcggacgtccgctgccgctggccgagatcacggaggaggactggcgttcc
agcatcgaccataacctgacctcgaccttcttcaccctcaagtgctttttgccggcgatg
ctggcgcgcggccatggcagcatcgtgaccatggcctcggccggcggacgcatggcttcg
ggcgcgccggccggctatggcgcggccaaggccggcgtcatcatgctgacccgccacgcg
gcgaacgaggtgggccgccaaggcatccgtgtgaactgcatttcgccctcggccgtgctg
accgagcgcaccgcgcagcgcatgccgccggcgcagcagcaagccatgctggccgctttc
ccgctgggacgcctgggccagccggatgatatcgccgccgccgcgctgttcctgctgtcc
gcaagctcgtcctggatcacgggtataacattggatatcgcgggtggccgcgtcatgaac
taa

DBGET integrated database retrieval system