Massilia sp. NR 4-1: ACZ75_14560 Help Entry ACZ75_14560       CDS       T04026                                  Name (GenBank) exodeoxyribonuclease   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism mnr  Massilia sp. NR 4-1 Pathway mnr03430   Mismatch repair Brite KEGG Orthology (KO) [BR:mnr00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     ACZ75_14560  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mnr03400]     ACZ75_14560 Enzymes [BR:mnr01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      ACZ75_14560 DNA repair and recombination proteins [BR:mnr03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      ACZ75_14560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Phage_coatGP8 Motif Other DBs NCBI-ProteinID:  AKU22514 UniProt:  A0A0K1JZI6 LinkDB All DBs Position complement(3542790..3543047) Genome browser AA seq 85 aa AA seqDB search MPKKMNDDTAAAAPASFEEAMAELAQLVTQMESGQLPLEASVAAYARGSELVKFCAGQLD KVESQVKVLEGDLLKPFAENEEGQP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcctaagaaaatgaatgacgacaccgctgccgcggcgccggcctccttcgaggaagcc atggccgaactggcgcagctggtgacgcagatggagtcgggccagctgccgctggaagcg tccgtcgccgcttatgcgcgcggttccgagctggtgaaattctgtgccggccagttggac aaggtggaatcccaggtcaaggtgctggagggcgacctgctcaagcccttcgccgagaat gaggagggccagccatga

DBGET integrated database retrieval system