KEGG   Massilia sp. NR 4-1: ACZ75_20040Help
Entry
ACZ75_20040       CDS       T04026                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mnr  Massilia sp. NR 4-1
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACZ75_20040
Enzymes [BR:mnr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ACZ75_20040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO HI0933_like FAD_binding_3 Thi4 AlaDh_PNT_C Glutaredoxin NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AKU23408
UniProt: A0A0K1K2H0
LinkDB All DBs
Position
4794481..4796046
Genome map
AA seq 521 aa AA seqDB search
MLDANLKTQLKAYLEKVVQPIEIVASLDGSAKSQELQGLLQDIQSLSDKITVIERPEANK
RKPSFSINRPGSDIGVTFAGIPMGHEFTSLVLALLQVGGHTIKLDAAVIEQIRNLDGDYN
FETYISLSCHNCPEVVQALNTMSVINPRIKVTTIDGGVFPQEVEARQIMAVPMMFLNGEH
FGQGRSSVEEILSKLDTGAGERQAAELNKKDVFDVLIVGGGPAGAAAAIYAARKGIKTGV
VADRFGGQVLDTLAIENFVSVKETDGPKFAVALEQHVKDYEVDIMNTQRAVKLVPGKVSE
IHTASGAVLKGKSVIISTGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVEHVTLIEFGAELRADAVLQRKLHSLKNVKVIVSAQTTEIHGDGKKV
NALSYTDRNSGDSHKVELEGVFVQIGLVPNTEWLKGTMELSRHGEIVVDARGQTSIPGVF
AAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRSSDEAIAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaaaacccagttgaaagcctatttggaaaaggtggtgcagccg
attgagatcgttgcatcgctcgacggctccgccaaatcgcaggaactgcaaggtctgctg
caggacatccagtccctgagcgacaagattaccgtgatcgagcgtccggaagccaataag
cgtaagccttccttctcgatcaaccgccctggcagcgatatcggcgtgaccttcgccggc
atcccgatgggccatgaattcacctccctggtgctggccctgctgcaagtgggcggccac
accatcaagctggacgcggccgtgatcgaacagatccgcaacctcgacggcgactacaac
ttcgagacgtatatctcgttgagctgccacaactgcccggaagtggtgcaggcgctcaac
accatgtcggtgatcaatccgcgcatcaaggtgaccaccatcgacggcggcgtcttcccg
caggaagtggaggcgcgccagatcatggcggtgccgatgatgttcctgaacggcgagcac
ttcggccagggccgcagcagcgtggaagagatcctgtccaagctcgacaccggcgccggc
gaacgccaggccgctgagctgaacaagaaagacgtgttcgatgtactgatcgtcggcggt
ggacctgccggcgcggccgcggcgatttacgccgcccgcaaaggcatcaagaccggcgtc
gtggccgaccgcttcggcggccaggtgctggacaccctcgccatcgaaaacttcgtctcg
gtcaaggaaaccgatggcccgaaattcgccgtggccctggaacagcacgtcaaggattac
gaagtcgacatcatgaatacccagcgcgccgtgaaactggtgccgggcaaggtcagcgaa
atccacactgccagcggcgcggtgctgaaaggcaagtcggtgattatttcgaccggcgcg
cgctggcgcgaaatcaatgtgccgggcgagaaggaataccgcaaccacggcgtagcctac
tgcccgcactgcgacggtcccctgttcaagggcaagcgcgtggccgtgatcggcggcggc
aactccggcgtggaagcggcgatcgacctggccggcctggtggaacacgtgacgctgatc
gaattcggcgccgaactgcgcgccgacgccgtgctgcaacgcaagctgcactcgctgaaa
aacgtgaaggtgatcgtttcggcccaaaccaccgagatccacggcgacggcaaaaaggtc
aacgccctgagctacaccgaccgcaatagcggcgactcgcacaaggtcgagctggaaggc
gtgttcgtgcagatcggcctggtgccgaataccgaatggctgaaaggcacgatggaattg
tcgcgccacggtgaaatcgtggtcgacgcccgtggccagacttcgatccccggcgtgttc
gccgccggcgacgtcaccaccgtgccctacaagcagatcgtgatcgctgtcggcgaaggc
gccaaagcctccttggccgctttcgaccacctgatccgcagcagcgacgaagccatcgcc
gcctaa

DBGET integrated database retrieval system