KEGG   Massilia sp. NR 4-1: ACZ75_21335Help
Entry
ACZ75_21335       CDS       T04026                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACZ75_21335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mnr02000]
    ACZ75_21335
Enzymes [BR:mnr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ACZ75_21335
Transporters [BR:mnr02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACZ75_21335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AKU23615
UniProt: A0A0K1K2K7
LinkDB All DBs
Position
5108700..5109371
Genome map
AA seq 223 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELGLDYEIVRYQRDAKTMLAPPELRRIHPLGKSPVIQDGE
VLVAESGAIIEYLVEQYGKGSLVPPAGTPDKLRWRYFLHYAEGSLMTPLLMKLVFDRVES
APAPFFVRPIAKAIAGKVKNSYILPQIRQHLDYLEGELAGSEWFAGSAFSAADIQMSFPL
EAATARGGLDGARPRLAAFLARIHARPAYQRALERGGPYELLR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgattactgtccaccacctcaacaattcccgttcgcagcgcgtgctgtggttgctggaa
gaactcggtctcgactatgagatcgtgcgctatcagcgcgatgccaagaccatgctggcg
ccgcccgagctgcgcaggattcatccgctgggcaagtcgcccgtgatccaggacggggag
gtgctggtggccgaatcgggcgccatcatcgagtacctggtggagcagtatggcaagggc
agcctggtgccgccggccggcacgccggacaagctgcgctggcgctatttcctgcactat
gccgaaggctcgctgatgacgccgctactgatgaagctggtcttcgaccgcgtggaaagc
gcgcccgcgccgttcttcgtgcggcccatcgccaaagccatcgccggcaaggtgaagaac
agttacatcctgccgcagatccggcaacacctcgattacctggaaggcgagctggccggc
agcgaatggttcgccggcagcgcgttcagcgcggccgatatccagatgagcttcccgctg
gaagcggccacggcgcgcggcggcctggatggcgcgcggccgcgcctggcagccttcctg
gcgcgcatccatgcccgccccgcctaccagcgcgcgctggaacgcggcggtccttacgaa
ttgctgcgctga

DBGET integrated database retrieval system