KEGG   Massilia sp. NR 4-1: ACZ75_26200Help
Entry
ACZ75_26200       CDS       T04026                                 

Definition
(GenBank) transporter
  KO
K07090  uncharacterized protein
Organism
mnr  Massilia sp. NR 4-1
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ACZ75_26200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AKU24433
UniProt: A0A0K1K5F1
LinkDB All DBs
Position
complement(6210030..6210791)
Genome map
AA seq 253 aa AA seqDB search
MPPVPPLELHTIVLIAAAGLFAGVQNALAGGGSFITFPALLLAGLNPLAANMTSTIAMFP
SQATSAVAGRKLVDDVGPLTFRQMFLISVVGGVLGAILLRITPPTFFARLVPWLVLFATS
MFAWGAFRKQPMHAASSMPKGLLVLVQSCIAIYGGYFGGGIGFLMLAALTIAGQQIRAAT
ATKNMLAMAMNAAATAIFAFSSLISWPAALALCAGGIAGGLAGSWLIYRLPPRLMRIFVV
IVGALLTVYMFLR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctgtcccgccgctggaattgcataccatcgtcctgatcgccgccgccggcctg
ttcgccggggtgcagaatgcgctggccggcggcggttccttcatcaccttccccgccctg
ctgctggccggcctgaatccgctggcggcgaatatgacctccaccatcgccatgttcccc
agccaggccacgtccgccgtcgccggacgcaagctggtggacgatgtggggccgctgact
ttccgccagatgttcctgatcagcgtggtgggcggggtgctgggcgccatcctgctgcgc
attacgccaccgaccttctttgcgcgcctggtgccgtggctggtgctgttcgccacctcg
atgttcgcctggggcgctttccgcaaacagcccatgcacgccgccagtagcatgccgaaa
ggcctgctggtgctggtgcaaagctgcatcgccatctatggcggctacttcggcggcggc
atcggcttcctgatgctggccgcgctgaccatcgccgggcagcagatccgcgccgccacc
gccaccaagaatatgctggcgatggcgatgaacgcggcggccaccgccatcttcgccttt
tccagcctgatcagctggcccgccgcgctggccctgtgcgcgggcggcattgccggcggc
ctggccggctcctggctgatctaccgcctgccgccgcgcctgatgcgcattttcgtcgtc
atcgtcggcgcgctgctgaccgtctacatgttcttgcgctga

DBGET integrated database retrieval system