KEGG   Microvirga ossetica: BB934_01300Help
Entry
BB934_01300       CDS       T05139                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
moc  Microvirga ossetica
Pathway
moc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:moc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BB934_01300
Enzymes [BR:moc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BB934_01300
Transporters [BR:moc02000]
 Other Transporters
  Pores ion channels [TC:1]
   BB934_01300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ANY77019
UniProt: A0A1B2EAR4
LinkDB All DBs
Position
296368..296994
Genome map
AA seq 208 aa AA seqDB search
MADELVFYTNPMSRGRIVRWMLEETGCAYRTEVLGFGKEMKAPAYLAVNPMGKVPAILHK
GTVVTEGAAICAYLADAFPEAGLAPAPQDSSRGTYYRWMFFAAGPMEAALSNKAFGFEVP
TDKQRAIGYGSIDDVLNALEQAVSQTEYIAGDRFTAADVYVGSQIGWGMMFGTLEKRPAF
EAYWKRIGNRPAAIRAREIDDALVPPKA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaactcgtcttctacaccaatcccatgtcgcgcggccgcatcgtgcggtgg
atgctggaggaaaccggctgcgcctaccggacggaggttttgggcttcggtaaagagatg
aaggctcccgcctatcttgccgtcaatcccatgggcaaggtgcccgcgatcctgcacaag
ggaacggtcgtcaccgagggcgccgccatctgcgcctatctggccgatgcctttcccgag
gctggcctcgcaccggcgcctcaagattcctcgcgaggcacctattatcgctggatgttc
tttgccgctggcccgatggaggccgcgctgagcaacaaggccttcggcttcgaggtcccg
accgacaagcagcgtgccatcggctatggcagcatcgacgatgtcctgaacgctctggaa
caggccgtctcgcaaaccgaatacatcgccggggatcgattcacggcggcggatgtctat
gtcggatcccagatcggctggggcatgatgttcggcaccctggaaaagcgccccgccttc
gaggcttattggaagcggatcggcaaccgcccggcggcgatccgggcgcgcgagatcgac
gacgcgctcgtgccgccgaaggcttga

DBGET integrated database retrieval system