KEGG   Microvirga ossetica: BB934_07710Help
Entry
BB934_07710       CDS       T05139                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
moc  Microvirga ossetica
Pathway
moc03030  DNA replication
moc03410  Base excision repair
moc03420  Nucleotide excision repair
moc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:moc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BB934_07710
   03410 Base excision repair
    BB934_07710
   03420 Nucleotide excision repair
    BB934_07710
   03430 Mismatch repair
    BB934_07710
Enzymes [BR:moc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BB934_07710
    6.5.1.6  DNA ligase (ATP or NAD+)
     BB934_07710
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BB934_07710
DNA replication proteins [BR:moc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BB934_07710
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BB934_07710
DNA repair and recombination proteins [BR:moc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BB934_07710
   NER (nucleotide excision repair)
    Other NER factors
     BB934_07710
   MMR (mismatch exicision repair)
    Other MMR factors
     BB934_07710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: ANY78134
UniProt: A0A1B2EDR9
LinkDB All DBs
Position
1648303..1650177
Genome map
AA seq 624 aa AA seqDB search
MNRFAALLDRLGYEPRRNAKLRLLADYFRHTPDPDRGYALAAMTGALMFKEAKAGLIRGL
VEERTDPELFRMSYHYVGDLAETVALIWPAPGHESVAPPSPLRGGVGVGVGKPEQSGADV
STDGSASTSKGALSPGRSTPTSNSSPQGGGGIGLGHNNPPPHVPTLTEVIETLATTSKSD
LPARVAGWMDALDETGRWALIKLITRELRVGVSARLAKTAVAQLGEIEPDEVELVWHGLE
APYEDLFAWVEGRGPKPESGNPAPFRPSMLSHPLEDEDFAKLEASDFLAEWKWDGIRLQA
ASGQGSDGRPVRRIYSRTGEDVSRAFPDLVEALDFEGAIDGELLIVREGRVQSFNVLQQR
LNRKAVTPKLISEFPAHLRVYDILFEGEEDLRALPFAERRRRLEALVARLDDPRIDLSPM
VPFSTWDDLAAARGDPASVGAGPDADAIEGCMIKRASSPYLPGRPKGYWYKWKRDPYLVD
AVMMYGQRGHGKRSSFYSDYTFGVWRSGPDGEELVPVGKAYHGFTDEELLKLDRYVRNHT
VKRFGPVREVEYGKDRGLVLEVAFEGLQRSTRHKSGVAMRFPRISRIRWDKPAAEADRIE
TLEKILERGEKEIHPLKEQQTKEA
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttcgccgccctcctcgaccgtctcggctatgagccccgccgcaacgccaag
ctgcggctgcttgcggattatttccgccacacccccgacccggaccgcggctatgcgctc
gccgccatgaccggcgcactgatgttcaaggaggccaaggccggcctgatccgcggcttg
gtggaggagcggaccgatccggagctttttcggatgtcctatcactatgtgggcgatctg
gcggagacggtagccctgatctggcctgccccggggcatgagagcgtggcgcccccctcc
cccttgcggggaggggtaggggtgggggtcggaaagccggagcagtcgggagccgatgtc
tccaccgacggctctgccagcacttcaaaaggcgccctctcacccggtcgttccaccccc
acctccaactcctccccgcaagggggaggagggatagggctcggccacaacaacccgccg
ccccatgttccgaccctcacggaggtcatcgagaccctcgcgaccacgagcaagagcgac
ctgccggctcgggttgcaggctggatggacgctctcgacgaaaccgggcgctgggcgctc
atcaagctgatcacccgagagctgcgggtcggcgtctcggccaggcttgcgaagacggct
gtcgctcagctcggtgagatcgagcccgacgaggtcgagctcgtctggcacgggctggag
gctccttacgaagatctcttcgcctgggtcgaaggccgcgggccgaagccggaatccggc
aatcccgccccgtttcgcccctccatgctctcgcaccctctggaggacgaggatttcgcc
aagctcgaagcctccgatttcctggccgagtggaaatgggacggcatccgccttcaggcc
gcgtcgggccagggcagcgacgggcgaccggtgcggcggatctactcccgcaccggcgag
gacgtctcccgcgcctttcccgatcttgtcgaggcgctcgatttcgagggtgctatcgac
ggcgaattgctgatcgtgcgcgaaggccgggtgcagagcttcaacgtgctgcagcagcgc
ctgaaccggaaggccgtgacgccaaagctcatctcggagtttccggcgcatctgcgcgtc
tacgatatcctgttcgagggcgaggaggacctgcgcgccctgcccttcgccgagcgacgc
cgtcggctggaggccctcgtcgcccgcctcgacgacccacgcatcgacctttcgcccatg
gtgcccttctcgacctgggacgatctcgctgccgcccgcggcgacccggcttcggtcggg
gcaggtcccgatgcggatgccatcgagggctgcatgatcaagcgggcgagcagcccctat
ctgcccggccgccccaagggctactggtacaagtggaagcgcgacccttacctcgtggac
gctgtgatgatgtacggccagcgcggccacgggaagcgctcgtccttctattccgactac
accttcggcgtctggcgcagcgggccggacggtgaggagttggtgcccgtgggcaaggcc
tatcacggcttcaccgacgaggagctcttgaagctagaccgctatgtccgtaaccacacg
gtcaaacgcttcggcccggtgcgggaggtggaatacggcaaggatcgcggcctcgtgctg
gaggttgccttcgaggggctgcagcgctcgactcggcacaaatccggcgtcgccatgcgt
tttccccgcatcagccgcatccgctgggacaagccggcggccgaggccgaccggatcgag
accctggagaagatcctggagcgcggcgagaaggagatccatcccctcaaggagcagcag
acgaaagaggcgtga

DBGET integrated database retrieval system