KEGG   Microvirga ossetica: BB934_11110Help
Entry
BB934_11110       CDS       T05139                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
moc  Microvirga ossetica
Pathway
moc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:moc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BB934_11110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:moc02000]
    BB934_11110
Enzymes [BR:moc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BB934_11110
Transporters [BR:moc02000]
 Other Transporters
  Pores ion channels [TC:1]
   BB934_11110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C_2 GST_C GST_N
Motif
Other DBs
NCBI-ProteinID: ANY78708
UniProt: A0A1B2EFF5
LinkDB All DBs
Position
2392216..2392926
Genome map
AA seq 236 aa AA seqDB search
MPYEFYYWPTIQGRGEFVRLALEEAGAEYVDVARRPKGMGAMTRLMDSAEKPPFAPPFLK
DGDTIVAQTAAILLYLGAWHGLAPKDPEGGLWTHQIQLTISDFVAEAHDSHHPVGVGLYY
EDQKEEARRRAEEFRESRIPKFLTWFETILARNPEGPAHLVGGRPTYADLSLFQVVEGLS
YAFPKATGRALKKLPKIAALHDSVMERPRIRAYLASPRRIPFNEDGIFRHYPELDQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgccctacgagttctactactggccgacgatccagggacgaggcgagttcgtgcgtctg
gcgctggaagaggccggagccgagtatgtggacgtggcgcggcggccgaaggggatgggg
gcgatgacgcgcctgatggacagcgccgagaagccgcccttcgccccgccttttctcaag
gatggcgacacgatcgtcgcccagacggcggcgatcctgctctatctcggggcctggcac
ggcctcgcccccaaggatccggaaggaggcctgtggacgcaccagatccagcttaccatc
agcgatttcgtagccgaggcccatgacagccatcatccggtcggcgtcgggctctattac
gaggaccagaaggaagaagcccgtcggcgcgccgaagagttccgcgagagccggatcccg
aaattcctgacctggttcgagacgatcctggcccgcaatccggaaggcccagcccatctc
gtcggcggcaggccgacctatgccgacctgtccctgttccaggtcgtcgaggggctctcc
tatgcttttcccaaggcgaccggccgggccctgaagaagctgcccaagatcgcagccctg
cacgattccgtaatggaacggccccgtatcagggcctatctcgcctctccgcgacgtatt
cccttcaatgaagacggcatcttccggcactaccctgagttggatcagtaa

DBGET integrated database retrieval system