KEGG   Microvirga ossetica: BB934_11285
Entry
BB934_11285       CDS       T05139                                 

Definition
(GenBank) histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
moc  Microvirga ossetica
Pathway
moc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:moc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BB934_11285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:moc01001]
    BB934_11285
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:moc02022]
    BB934_11285
Enzymes [BR:moc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BB934_11285
Protein kinases [BR:moc01001]
 Histidine kinases
  OmpR family
   BB934_11285
Two-component system [BR:moc02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   BB934_11285
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_5 HATPase_c_3 Rnk_N
Other DBs
NCBI-ProteinID: ANY78739
UniProt: A0A1B2EFM3
LinkDB
Position
2430490..2432352
AA seq 620 aa
MKAEPIHADATFDDPPAPRSALERLKHFGRMIVQRGSSSLTRRIVVLNLAGLVALLVGFL
YLNQFREGLIEARVQSLLTQGEIIAGAIAGSATVETNTITIDPDQLLQMQAGETERFTDE
SFSSLEFSINPERVAPLLRRLVTPTKTRARIFDRDGLLLLDSRSFYSRGDILRMELPPVA
NVEDTTSVMERTWNSIRKMFRRTKRPVLEEAGPANGKSLPEVQQAFAGQQSSVVRVNTRG
ETIVSVAVPIQRFRAVQGALLLSTQEGDIDAIIASERFALLQVFLVAAVVMIVLSLFLAG
AIAGPVRRLAEAAERVRWGTKSRQEIPDFTGRADEIGHLSGALRDMTKALYNRIDAIESF
AADVAHELKNPLTSLRSAVETLPLARSDDSRQRLLSIIQHDVKRLDRLISDISDASRLDA
ELARADAEPVDMVRLLEAVVSVANERRQEHEPLITLNIDRQAHGRDAFLVLGHDSRLGQI
FNNLIDNARSFSPPDETVRVSIRRRKNEVEILVEDSGPGIEPDALDRIFERFYTDRPEQG
FGQNSGLGLSISRQIIEAHRGSIRAENRLGSPDETGEPRRLGARFVIRLPIEGAKAKKDQ
DRKDQEKKDKARREPGKREA
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaaggctgagcccatccacgccgacgcgacattcgacgacccgccggctccccggagc
gctcttgagcggctgaagcatttcggccgcatgatcgtccagcgcggctcgtcgagcctg
acccgccgcatcgtcgtgctcaacctcgccggcctcgtcgcgctcctcgtcggcttcctc
tacctcaaccagttccgcgaggggctgatcgaagcccgcgtgcagagccttctgacccag
ggcgagatcatcgcgggcgccatcgccggctcggcgacggtcgagaccaacaccatcacc
atcgatccggaccagctgcttcagatgcaggccggcgaaacggaacggttcaccgacgaa
tccttctcgtcgctcgaattctcgatcaaccccgagcgggtcgcgcccctgctgcgccgg
ctggtgacgcccaccaagacccgcgcccggatcttcgacagggacggcctgctgctgctc
gattcccggtcattctattcccgcggcgacatcctgcgcatggagctgccgccggtcgcg
aatgtggaagacaccaccagcgtgatggagcggacctggaacagcatccgcaagatgttc
cggcgcaccaagcgtccggtgctcgaggaggccggccccgccaacggcaagtctctgccg
gaagtgcagcaggcctttgccggccagcaatcgagcgtggtgcgcgtcaacacccggggc
gagaccatcgtctcggtggctgtgccgatccagcgcttccgcgcggtccagggcgcgctt
ctgctctcgacccaggaaggcgatatcgacgccatcatcgcctccgagcgcttcgccctg
ctgcaggtcttcctggtggcggccgtggtcatgatcgtcctgtccctgtttctcgccggc
gccattgccggcccggtccgccgcctggcggaggccgccgaacgggtgcgctggggaacg
aagtcgcgccaggagatccccgacttcaccggccgcgccgacgagatcggccatctgtca
ggcgcgcttcgcgacatgacgaaggcgctctacaaccgcatcgacgccatcgagagcttc
gccgcggacgtggcgcacgagctgaagaacccgctgacctcgctgcgcagcgcggtcgag
accctgccgctcgcccgcagcgacgactcgcgccagcggctgttatccatcattcagcat
gacgtgaagcgcctcgaccggctgatcagcgacatctcggacgcctcgcgcctcgatgcg
gagctcgcccgcgccgatgcggagcccgtggacatggtccgcctgctcgaggctgtggtc
tccgtcgccaacgagcgccgccaggagcacgaaccgctcatcaccctcaacatcgaccgg
caggcgcatggccgggatgccttcctggtcctcggccacgacagccgcctaggccagatc
ttcaacaacctgatcgacaacgcgcgctccttctccccgcccgacgagacggtgcgggtg
tcgatccggcgccgcaagaacgaggtcgagatcctcgtggaggacagcgggcccggcatc
gagcccgacgccctcgaccggatcttcgagcgtttctacaccgaccggcccgagcagggc
ttcggccagaattcgggtctcggcctgtcgatctcgcggcagatcatcgaggcccatcgc
ggctcgatccgcgccgagaaccggctcggctcccccgacgagaccggcgagccccggcgc
ctcggcgcccgcttcgtcatccgcctgcccatcgaaggggcgaaggccaagaaggatcag
gacaggaaggaccaggagaagaaggacaaggccaggcgcgagccggggaagagggaagcg
tga

DBGET integrated database retrieval system