KEGG   Microvirga ossetica: BB934_12480Help
Entry
BB934_12480       CDS       T05139                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
moc  Microvirga ossetica
Pathway
moc00061  Fatty acid biosynthesis
moc00780  Biotin metabolism
moc01100  Metabolic pathways
moc01130  Biosynthesis of antibiotics
moc01212  Fatty acid metabolism
Module
moc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:moc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BB934_12480
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BB934_12480
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BB934_12480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:moc01004]
    BB934_12480
Enzymes [BR:moc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BB934_12480
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BB934_12480
Lipid biosynthesis proteins [BR:moc01004]
 Fatty acid synthase
  Component type
   BB934_12480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ANY81781
UniProt: A0A1B2EP90
LinkDB All DBs
Position
2669705..2670535
Genome map
AA seq 276 aa AA seqDB search
MTGLMQGKRGLIMGVANDHSIAWGIAKTLAKHGAELAFTYQGEALGKRVTPLAQSLGSDL
VVPCDVEDIASVDAVFETLDRRWDGLDFVVHAIGFSDKSQLKGSYVDVTTRENFSRTMVI
SCFSFTEIAQRAAKRMRNGGSLLTLTYGGSTRVMPNYNVMGVAKAALEASMRYIASDLGP
QGIRCNAISAGPVRTLAGAGISDARLMFTYQKAHAPLRRTVTIEDIGGSALYLLSDLSNG
VTGEIHYVDSGYNVISMPRPEILKAQDAAGVTGEES
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggtctgatgcaaggaaagcgcggcctcatcatgggcgtcgccaacgaccattcc
atcgcctggggcatcgccaagaccctggccaagcacggcgcggaactcgcgttcacctat
cagggggaggccctgggcaagcgcgtgacgccgctggcgcagtcgctcggctccgatctc
gtcgtcccctgcgacgtggaggacatcgcctcggtggatgcggtgttcgagaccctcgac
cggcgctgggacggcctcgatttcgtggtccacgccatcggcttctccgacaagtcgcag
ttaaagggctcctatgtggacgtcaccactcgcgagaatttttcccgcaccatggtgatc
tcctgcttctccttcacggagatcgcccagcgcgcggccaagcgcatgagaaacggcggc
tcgctgctcaccctcacctatggcggctcgacccgggtcatgccgaattacaacgtcatg
ggcgtggcgaaggcggcactcgaagcctccatgcgctacatcgcgtccgatctcgggccc
cagggcatccgctgcaacgccatctcggcgggtcccgtgcgcacgctcgccggcgccggc
atctcggatgcgcgcctgatgttcacctaccagaaggcccacgcccccttacgccgcacg
gtgaccatcgaggatatcggcggctcggcgctctatctgctctcggacctctcgaacggc
gtgaccggcgagatccactacgtcgattccggctacaacgtcatctcgatgccccgtccc
gagatcctcaaggcccaggatgcggccggcgtgaccggcgaggagagctag

DBGET integrated database retrieval system