KEGG   Microvirga ossetica: BB934_12715Help
Entry
BB934_12715       CDS       T05139                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
moc  Microvirga ossetica
Pathway
moc00340  Histidine metabolism
moc01100  Metabolic pathways
moc01110  Biosynthesis of secondary metabolites
moc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:moc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BB934_12715
Enzymes [BR:moc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BB934_12715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG FTZ
Motif
Other DBs
NCBI-ProteinID: ANY78964
UniProt: A0A1B2EG57
LinkDB All DBs
Position
2716342..2716662
Genome map
AA seq 106 aa AA seqDB search
MTSFTLNDLARIVAERAAAPPAESYTAKLIAGGPARAAKKLGEEAVEAVIAAVEGDRQNL
TAEAADVLYHLLVVLQGANIPLIDVMAELERRTAQSGLAEKAARRT
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgacctccttcaccctcaacgacctcgcccgcatcgtcgccgagcgcgctgcggcgccg
ccagccgaatcctatacggccaagctcatcgccggcgggcccgcaagggcagccaagaag
ctgggggaggaggcggtggaggccgtcatcgccgccgtcgagggcgaccggcagaacctc
acggcggaagcggcggacgtgctgtatcatcttttggtcgtgttgcagggcgcaaacatt
cctctaattgacgtcatggccgaactggagcgccgcacggcgcagtcgggtcttgcggag
aaggccgcgcgcaggacctaa

DBGET integrated database retrieval system