KEGG   Microvirga ossetica: BB934_15155Help
Entry
BB934_15155       CDS       T05139                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
moc  Microvirga ossetica
Pathway
moc00620  Pyruvate metabolism
moc00680  Methane metabolism
moc01100  Metabolic pathways
moc01120  Microbial metabolism in diverse environments
moc01200  Carbon metabolism
Module
moc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:moc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB934_15155
  Energy metabolism
   00680 Methane metabolism
    BB934_15155
Enzymes [BR:moc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BB934_15155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANY79391
UniProt: A0A1B2EHE2
LinkDB All DBs
Position
3233980..3236766
Genome map
AA seq 928 aa AA seqDB search
MSLINPDVTPEKDFPLRDDIRLLGRILGDTIREQEGEATFEIVERIRQTSIRFHRDEDEI
ARRELETILNSLSRGRTNQIIRAYSYFSHLANLAEDQHHVRRSRAHAMAGVHAMEAAVPR
EGTLGRALKLIQEAGISHTALQAFFGSALVCPVLTAHPTEVRRKSTIDREMEISQVLARR
DRQRLTPEEEASCQESLRRAILTLWQTSILRRNRLKVIDEVTNGLSYYDNTFFKELPHVY
ASLEDQLAAMDPAWGNVEVPSFLRMGSWIGGDRDGNPFVTADALRQALLLQSKHALGFYL
DELHCLGAELSLDGRYVNVSDEVQELAKSSPDLSLHRQDEPYRRAITGIYARLAATAARL
GHGDVARHAVGEAPAYDSLEEFEGDLSILHRSLRSNGSGSLTRGRLRKLRRAVDVFGFHL
ASLDMRQNSDVHQRVIAELFEKAIPGTDYEGLPEDKRVALLLEELRTPRLLTSPYLEYSP
ETSSELAIVHEAAGAHRQYGRTAVPNYVISKASDPSDILEVALLLKEAGLLRPREGEMDV
NIIPLFETIADLRHCSGVMDSLFALPDYMRLLRSRGQAQEVMLGYSDSNKDGGFLTSGWE
LYKAEIELIEVFKRHGVALRLFHGRGGSVGRGGGPSYQAILAQPGGAVQGAIRITEQGEV
IAGKYSNPDLGRRNLEILASATLEATLLHSGQSAPREEYLNAMEELSDGAFKAYRALVYE
TEGFERYFWESTVIGEIANLNIGSRPASRTNSRRIEDLRAIPWVFGWAQCRLMLPGWYGF
GSAVNEWLEKRPDKGLALLQEMYREWPFFQALLSNMDMVLAKSNIAIASRYAKLVEDEGL
RDAIFPRLRREWEDSIQQLLAIMQQQSLLDDNPLLARSIRNRFPYLDPLNHLQIELLKRH
RSGDADEQVVQGIHLSINGIAAGLRNSG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgatcaatcccgacgtcacacccgagaaggattttccccttcgcgacgacatc
cggcttctgggacgcatcctcggcgacacgattcgcgagcaggagggcgaggcgaccttc
gagatcgtcgagcgcatccgccagacctcgatccgcttccatcgcgacgaggatgaaatt
gcccgtcgtgagctcgagacgatcctgaacagcctgtcgcgcggacgcaccaaccagatc
atccgggcctacagctatttctcgcatctggcgaatctggccgaggaccagcaccatgtc
cgccgctcacgagcccatgcgatggcgggcgttcatgccatggaggctgcggtgccgcgc
gagggaacgctcgggcgcgcgctcaagctcatccaggaggcgggcatcagccatacggcg
ctgcaggccttcttcggctccgcccttgtctgcccggttctgaccgcgcatccgacggaa
gtgcgccgcaagagcaccattgatcgggagatggagatctcacaggttctggcacggcgg
gaccgtcagcgcctgacaccggaggaggaggcttcgtgtcaggaatccctgcgccgcgcc
atcctcacgctctggcagacgagcattctgcgccggaatagactgaaagtgatcgacgag
gtcacgaacggcctgtcctattacgacaataccttcttcaaggaattgccgcacgtttac
gcctccctggaggaccagctcgcggccatggatcccgcctggggcaatgtggaagtcccg
tccttcctgcgcatggggagctggatcggcggcgatcgcgacggcaatcccttcgtgacg
gcggatgcattgcgtcaggctctgctgctgcagagcaagcacgccctcggcttctatctg
gacgagctccattgccttggcgccgaactgtcgctcgacgggcgctatgtgaacgtctcc
gacgaggtccaggaactcgccaaatcctctcccgatctatcgctccatcgccaggacgag
ccctatcgccgggccatcacgggcatctatgcacgccttgcggcaaccgccgcgcggctg
gggcatggcgacgtggcgcgccatgcggtgggcgaggcgccggcctatgacagccttgag
gaattcgaaggtgatctctcgatcctgcaccgctccctgcgctcgaacggatcgggctcc
cttacgcgaggccgcctgcgcaagctgcgtcgcgcggtcgatgtgttcggctttcatctg
gcgagcctcgacatgcgccagaattccgacgtccatcagcgcgtgattgccgagctcttt
gagaaggccatccccggcacggattacgaggggctgccggaagacaagcgcgtcgccctg
ctcctggaagagctccggacgccgcgcctcctgacatcgccctatctcgaatactccccc
gaaacctcatccgagcttgccatcgtccacgaggcggccggggcgcaccgccagtacgga
cgcaccgccgtgccgaactacgtcatctcgaaggcgagcgacccgtccgacattctcgag
gtcgccctgcttctcaaggaggctggcctgctgcgtccgcgcgaaggcgagatggatgtg
aacatcatcccgctcttcgagaccatcgccgacctgcgccattgcagcggcgtgatggat
tcgctcttcgcactgcccgactacatgcgactgttgcgcagccgcggccaggcgcaggag
gtgatgctcggctattccgacagcaacaaggacggcggcttcctcacctcgggttgggag
ctctacaaggcggagatcgagctgatcgaggtgttcaagcggcatggcgttgcgcttcgc
ctcttccacggccggggcggctccgtgggccgcggcggtgggccgagctatcaggcgatc
ctcgcccagccgggcggtgcggtgcagggcgccatccgcatcacggaacagggtgaggtg
atcgcgggcaaatattcgaatccggatctcgggcgccgcaacctcgaaatcctcgcctcc
gcgactctcgaagccacgttgctgcattccggccagtccgcaccgcgggaggaatatctc
aacgccatggaggagctttcggacggcgccttcaaggcctatcgcgcgctcgtctacgag
acggaaggcttcgagcgctatttctgggaatccacggtgatcggcgagatcgccaacctg
aatattggcagccggcctgcctcgcgcaccaattcgcggcgcatcgaggatctgcgcgcc
attccctgggtgtttggctgggcgcagtgccgcctcatgctgccgggctggtacggtttc
ggatccgccgtcaatgaatggctcgagaagcggcccgataaaggtctggcgctcctgcag
gaaatgtaccgcgaatggccgtttttccaggcgctgctctcgaacatggacatggtgctg
gcgaagagcaacatcgctatcgcctcgcgctatgcgaagctcgtcgaggacgagggcctg
cgcgatgccatcttcccgcgcctgcggcgggaatgggaggattcgatccagcagctgctc
gccatcatgcagcagcaatcgctgctcgacgacaacccgctgctggcccgctcgatccgc
aaccgtttcccctatctcgacccgttgaaccatctgcagatcgaattgttgaagcgccac
cgttcgggcgatgcggacgagcaggtcgtgcagggcattcacctgtccatcaacggcatc
gcggcgggcctgcgcaacagcggctaa

DBGET integrated database retrieval system