KEGG   Microvirga ossetica: BB934_16355Help
Entry
BB934_16355       CDS       T05139                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
moc  Microvirga ossetica
Pathway
moc00010  Glycolysis / Gluconeogenesis
moc00620  Pyruvate metabolism
moc01100  Metabolic pathways
moc01110  Biosynthesis of secondary metabolites
moc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:moc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB934_16355
   00620 Pyruvate metabolism
    BB934_16355
Enzymes [BR:moc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BB934_16355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ANY79604
UniProt: A0A1B2EI09
LinkDB All DBs
Position
complement(3493125..3494642)
Genome map
AA seq 505 aa AA seqDB search
MNKPEFLTLSHVPFKERYGNFIGGQWVEPVNGRYFENTSPITGKPVCEIARSDKDDIEKA
LDAAHAAKDAWGKTAPAERARILNEIADRMEANLDTLALAETWDNGKPIRETTAADMPLA
IDHFRYFAACIRAQEGSVAEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKMAPALAA
GNCVVIKPAEQTPASILVWAEMVADLLPPGVLNIVNGYGLEAGKPLASSSRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFDDVTAEDDDYLDKAIEGFVMFALNQGEVC
TCPSRALVQESIYDKFMEKALKRVEAIKQGSPLDPSTMIGAQASSEQLEKILSYIDIGKQ
EGAQVLTGGERNNLPGDLAGGYYVKPTVLKGHNRMRVFQEEIFGPVVSVTTFKDENDALA
IANDTLYGLGAGVWTRNGNRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNLLVSYSSKALGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccagaattcctgacactctcgcatgtgccgttcaaagagcgctatggcaac
ttcatcggcgggcaatgggtggagcctgtcaacggccgctatttcgagaacacgtcgccg
attaccggaaagccggtctgcgagatcgcccgctccgacaaggacgacatcgaaaaggcg
ctggatgcggcccatgcggctaaggatgcctggggcaagacggcgcccgccgaacgggca
cgcatcctcaacgagatcgccgaccgcatggaggccaatctcgacacgttggccctggcg
gagacctgggacaacggcaaaccgatccgcgagacgaccgcagccgacatgccgctcgcc
atcgaccatttccgctatttcgccgcctgcatcagggcccaggaaggctcggtcgcagaa
atcgaccacgatacggtcgcctatcatttccatgagccgctcggcgtcgtcggtcagatc
attccctggaacttcccgatcctcatggcagcctggaagatggctccggcccttgcagcg
ggcaactgcgtcgtcatcaagccggcagaacagacgccggcctcgatccttgtctgggcg
gagatggtggccgacctgctgccgcccggcgtcctgaacatcgtcaacggctacggcctg
gaggccggaaaaccgcttgcctcgagttcgcgcatcgccaagatcgcgtttaccggcgag
acgaccaccggccgcctgatcatgcaatatgcgagccagaacctgatccccgtgacgctc
gagcttggcggcaagtcgcccaacatcttcttcgacgacgtgacggcggaggacgacgac
tatctcgacaaggcgatcgagggcttcgtgatgttcgctctgaatcagggcgaggtctgc
acctgccccagccgcgccctggttcaggaatcgatctacgacaagttcatggagaaggcg
ctcaagcgcgtcgaggcgatcaagcagggaagcccgctcgatccttcgacgatgatcggc
gcccaggcctccagcgagcagcttgagaagatcctcagctatatcgacatcggcaagcag
gaaggtgcgcaggtgctgaccggcggcgagcgcaacaacctccctggggatctcgccggc
ggatactacgtgaagccgaccgtcctgaagggccacaaccgcatgcgtgtcttccaggag
gaaatcttcggaccggtcgtctccgtcaccacgttcaaggacgagaacgacgctctggcg
attgccaatgacaccctctatggcctcggcgccggcgtctggacccgcaacggcaatcgc
gcctatcgcttcggccgtgccatccaggcgggacgcgtctggacgaactgctaccatgcc
tatccggcccatgcggcattcggcggatacaaacaatccggcatcggccgcgaaacgcac
aagatgatgctcgatcactatcagcagaccaaaaacctgctggtcagctacagcagcaag
gcgcttggcttcttctga

DBGET integrated database retrieval system