KEGG   Microvirga ossetica: BB934_19085Help
Entry
BB934_19085       CDS       T05139                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
moc  Microvirga ossetica
Pathway
moc00473  D-Alanine metabolism
moc00550  Peptidoglycan biosynthesis
moc01100  Metabolic pathways
moc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:moc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BB934_19085
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BB934_19085
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BB934_19085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:moc01011]
    BB934_19085
Enzymes [BR:moc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BB934_19085
Peptidoglycan biosynthesis and degradation proteins [BR:moc01011]
 Precursor biosynthesis
  Amino acid ligase
   BB934_19085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 GARS_A ATP-grasp ATPgrasp_ST ATPgrasp_TupA CbiA
Motif
Other DBs
NCBI-ProteinID: ANY80071
UniProt: A0A1B2EJC8
LinkDB All DBs
Position
4046848..4047771
Genome map
AA seq 307 aa AA seqDB search
MAKHVAILYGGWSAEREVSLASGRACCKALEGQGYKVTPIDVQPDIATVLQAVSPDVVFN
ALHGRVGEDGTIQGLLEVLRIPYTHSGVLASALAMQKDKAKIVMAAAGVPVPRGMVVNRS
EAAKSHVLPAPYVIKPVNEGSSVGVIIVREDRSHPPQELTREDWAYGEQVLVESYVAGRE
LTCAVMGDRALGVIDIQPATGVFYDYDAKYVKGGSIHVLPAEIKPNIYQKVQELALTAHQ
ALGCRGISRADLRYDDTPGGTGELVVLEVNTQPGMTETSLVPELAAHAGYSFGELVQWMV
EDATCNR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcatgttgccatcctttatggcggctggtcggcggagcgcgaggtgagcctg
gcttcgggccgggcatgctgcaaggcgctggaggggcagggctataaggtcacccccatc
gacgtgcagcccgatatcgccaccgtcctgcaggccgtttcgccggatgtggtgttcaac
gcgctccacgggcgcgtgggcgaggacggaacgatccagggtctgctggaagtcttaaga
atcccctatacccattccggcgtcctcgcctcggcgctcgccatgcagaaggacaaggcc
aaaatcgtcatggcggcggccggcgtgcccgttccgcgcggcatggtcgttaaccgttcg
gaggcggcgaaaagccacgtcctgccggctccttatgtgatcaagccggtcaacgagggc
tcctcggtgggcgtcatcatcgtgcgcgaggaccgttcccatccgccccaggaactgacc
cgggaggattgggcctacggcgagcaagtccttgtggaatcttatgttgcgggccgcgag
ctgacctgcgcggtcatgggcgacagggcgctcggggtcatcgacatccagcccgccacc
ggggtcttctacgactacgacgcaaaatatgtgaaggggggctccattcacgtcctcccg
gcagaaattaaaccgaatatttaccaaaaggtccaagagttggcgttaacggcgcatcaa
gcgctcggctgtcggggaatcagccgcgccgacttgcgatacgacgatactccgggagga
accggggaactcgtggtactcgaggtcaacacgcaacccggcatgaccgagacgagcttg
gtgccagaactggcagcccacgcgggctattcgtttggcgagcttgtgcaatggatggtg
gaggacgctacctgcaaccgatga

DBGET integrated database retrieval system