KEGG   Microvirga ossetica: BB934_22890Help
Entry
BB934_22890       CDS       T05139                                 

Definition
(GenBank) iron ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
moc  Microvirga ossetica
Pathway
moc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:moc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BB934_22890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:moc02000]
    BB934_22890
Transporters [BR:moc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    BB934_22890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_1 SBP_bac_8 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: ANY80723
UniProt: A0A1B2EL54
LinkDB All DBs
Position
complement(4836829..4837866)
Genome map
AA seq 345 aa AA seqDB search
MVKLSFGRGLLFGTAVLGVLAGSGASASAEEVLNIYTAREPGLIKPVLDEFTKETGIKVN
TIFIANGLEERIRTEGANSPADVIVTVDIGRLAAAKDYGVTQAVKSEALEKVVPAVYRDP
EGHWFGIALRGRVVYASKERVKQDKITYEELADPKWKGKVCIRSGQHLYNISLIAAMIAH
KGEAKAEEWLKGVKANLAKKPSGGDREQARDILAGVCDIAVGNTYYVSLMLNGTDADQKK
WGEAINVILPTFEGGGTHVNVSGLALAKNSPNKANAMKFMEYMVSDESQRIHADANSEYP
VEAGIKIHPTIASFGELKADNVQIAEIAKLRKKASELVDKVGFDQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaactttcgtttggacgtgggctgctcttcgggactgcggttctcggtgttctt
gcaggttcgggcgcttcggcttcggccgaggaggtgctgaacatctacaccgcccgtgag
cctggcttgatcaagcccgtgctcgacgagttcaccaaagagaccggcatcaaggtcaac
acgatcttcatcgccaacggcctcgaggagcgcatccgcaccgaaggcgcgaacagccct
gccgacgtgatcgtcacggtcgatatcggccgcctggccgccgccaaggattacggcgtg
actcaggccgtgaagtccgaggcgctcgagaaggtcgtcccggctgtctatcgcgatccg
gaaggccactggttcggcatcgcccttcgcggccgtgtcgtctacgcctccaaggagcgc
gtgaagcaggacaagatcacctatgaagaactcgccgatcccaagtggaagggcaaggtc
tgcatccgctccggccagcatctctacaacatcagcctgatcgccgccatgatcgcccat
aagggcgaggccaaggccgaggaatggctgaagggcgtgaaggccaacctcgccaagaag
ccttcgggcggcgaccgcgagcaggccagggacatcctcgccggcgtctgcgacatcgcc
gtcggcaacacctactacgtatcgctcatgctcaacggtaccgacgcggaccagaagaaa
tggggcgaggcgatcaacgtgatcctgccgaccttcgaaggcggcggcacccatgtgaac
gtctccggccttgcgctggcgaagaactcgcccaacaaggccaatgccatgaagttcatg
gaatacatggtctcggacgagtcgcagcggatccacgccgacgccaattccgaatatccg
gtcgaggccggcatcaagattcacccgaccatcgcctcgttcggcgagctgaaggccgac
aacgtgcagatcgccgagatcgccaagctgcgcaagaaggcgagcgagctggtcgacaag
gtcggcttcgaccaataa

DBGET integrated database retrieval system