KEGG   Microvirga ossetica: BB934_23270Help
Entry
BB934_23270       CDS       T05139                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
moc  Microvirga ossetica
Brite
KEGG Orthology (KO) [BR:moc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BB934_23270
Enzymes [BR:moc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BB934_23270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANY80789
UniProt: A0A1B2ELG3
LinkDB All DBs
Position
4910196..4910903
Genome map
AA seq 235 aa AA seqDB search
MAVSPQQPIELYYWPTPNGWKITIMLEECGLPYTVLPVNIGKGDQFRPEFLSISPNNKMP
AIVDHEGPGGKPISVFESGAILQYLGRKTGKFYPQDERARVEVDQWLFWQMGGFGPMLGQ
AHHFRIYSPEKIPYAIDRYTNETHRLYGVLNKRLADREFVAGEYSIADMAIAPWAKLWER
QGQNIDEFPHAKRWLETVLARPAVQRGIAVSSEDRGKTDLTDPAVQAILFGQRAR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccccgcagcaaccgatcgagctctattactggccgaccccgaacggatgg
aagatcaccatcatgctcgaggaatgcgggctgccttacaccgtcctgcccgtcaatatc
ggcaagggcgatcagttcaggccggaattcttgagcatctctcccaacaacaagatgccg
gccatcgttgatcatgaggggccggggggcaagccgatctcggtgttcgagtctggcgcg
atcctgcaatatctcggccgcaagacgggcaagttctacccgcaggacgaacgggcgcgc
gtcgaggtcgaccaatggctgttctggcagatgggcggcttcggccccatgctcggccaa
gcgcaccatttccgtatctactcgccggaaaagataccctacgccatcgaccgctacacc
aacgagactcatcgcctctacggggtgctgaacaagcgcctggccgatcgggaattcgtg
gcgggcgagtattccatcgccgacatggccatcgccccctgggcgaagctctgggagcgc
cagggccagaacatcgacgagtttccccatgccaagcgctggctcgagaccgtgctcgcc
cgcccggcggtccagcgcggcattgcggtgagctccgaggaccgtggaaagaccgacctc
acggatccggcggtccaggccatcctgttcgggcagagggcgcggtag

DBGET integrated database retrieval system