KEGG   Microvirga ossetica: BB934_24815Help
Entry
BB934_24815       CDS       T05139                                 

Definition
(GenBank) adenylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
moc  Microvirga ossetica
Pathway
moc00230  Purine metabolism
moc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:moc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BB934_24815
Enzymes [BR:moc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     BB934_24815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc dCache_1 HAMP
Motif
Other DBs
NCBI-ProteinID: ANY81046
UniProt: A0A1B2EM44
LinkDB All DBs
Position
5256073..5258016
Genome map
AA seq 647 aa AA seqDB search
MRVRFGYQLSITALFVGVVLSVGLALVFLSFDRARSITRTAALAFIDRVADHTADRVDGQ
FKDVLDILEVLRQLPPVETGAILDNPPLYTILAALLRRHGQLYNLYVGYGDGGFIELDGL
DRAGSALRRELRAPPEAEFRLSVVETPPGGTERQRFTYYLSHDMTVLAREQRAADYDPRE
RPWYRGAFQPGASAITDPYVFKVAALIGYTVRAPFTQGRGGIAAGDILLTETDAFLRSQR
LGTSGVVFLFDDNGRIVAHPGMSDLLKASAPDAALDLPRLDQLVSVDIARPLAAWRQGGS
AQQIFDTKDGRTYVAAFRSIRTAGVSGLRLAVMAPLDDFFAEIEAGRRRMVLLALGFVLA
ALPAVWWIGSVLSRSMKALARETDRIQRFDTAGPPVEVRSVIREIDDLGQSVATMRTVVR
TFASFVPKRLVQQLVATGDALRLGGSRREVTILFTDIAGFTNITEKADPEQVMIRTSRYL
AVLSAAITEHGGTVDKFVGDAIMAIWNAPSDDSDHVAHACSAVLACREANRRLNIEFERE
GWPAYRTRYGLHTGEAVVGTIGSDDRMAYTVLGATVNLAARLEPLNKDYGTEIMVSDAIR
RQVADRFAFRPIDTLTPKGFATSIRIYELLGQLDREGEGTCGSIKAG
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttcggttcggttatcagctctccatcaccgcgctgttcgtgggcgtcgtgctg
tcagtcggtctggcgcttgtctttctgagtttcgaccgggcgcgctccatcacgcgcacg
gcggccttggccttcatcgaccgcgtcgccgaccatacggcggaccgggtggacgggcag
ttcaaggacgtgctcgacattctcgaggtgctgcggcagcttccgcccgtcgaaaccggc
gcgatcctcgacaatccgccgctttataccatcctcgcagctcttctgcgccggcatggg
cagctttacaacctctatgtcggctatggcgacggcggcttcatcgagctcgatggcctc
gaccgcgccgggtcggccttacgccgggaactccgcgcgccgccagaggccgagttccgg
ctctcggtcgtcgagacgccgccgggcgggaccgagaggcagcggtttacctattaccta
tcccatgacatgacggttctcgcgcgcgaacagcgagcggccgattacgatccgcgcgag
aggccctggtaccgcggagcctttcagccgggcgccagcgcgatcaccgatccttacgtg
ttcaaggtcgccgcgctcatcgggtatacggtcagggccccgttcacgcagggacgaggc
gggatcgccgccggcgacatccttctcacagagacggatgccttcctgcgctcccagcgg
ctcggcacctcgggcgtcgtttttctcttcgacgacaatggccggattgtcgctcatccg
ggaatgtcagatctcctcaaagccagcgcgccagacgccgcgctcgacctgccgcgcctc
gatcaactcgtgagcgtcgacatcgctcggcctctggccgcctggcggcaaggcggttcg
gcgcagcagatcttcgacaccaaagacggccggacctatgtggccgccttccgctcgatc
agaactgcgggtgtttccggtctccggctcgccgtcatggcgccgctcgatgatttcttc
gccgagatcgaggccggacggcgtcggatggttctgctggcgctcggtttcgttctcgcc
gctttgcctgccgtctggtggatcggctcggtgctgtcgcggtccatgaaggcactcgcg
cgggagaccgaccggatccaacgcttcgacacggccggaccgcctgtggaggtccgttcg
gtgatccgggagatcgacgatctcgggcaatccgtcgcgaccatgcggaccgtggtgcgg
acattcgcgagcttcgtgcccaagcggctggtgcagcagctcgtcgccacgggtgatgcc
ctccggctgggcggttcacgtcgcgaggtcacgatcctgttcacggacatcgccggtttc
accaacatcaccgagaaggcggaccccgagcaggtgatgatccgcacctcgcgatatctg
gctgtgctgtcggcggcgatcacggaacatggcgggacggtcgacaaattcgtcggcgat
gcgatcatggcgatctggaatgcgccctcggacgattcggatcatgtcgcccatgcctgc
agcgcggtgctggcctgccgggaggccaaccgaaggctgaacatcgaattcgaaagagaa
gggtggccggcctaccggacgcggtacggacttcacaccggtgaggcggtcgtcggcact
atcggatcggacgaccggatggcttatacggttcttggcgcgaccgtgaacctggcagcg
cgactggagccgctcaataaggattacggaaccgagatcatggtcagcgatgcaatacgt
cggcaggttgccgaccgcttcgcattccggcctatcgacacgctcacgccgaagggcttc
gcgacgtcgatccgcatctacgagttgctgggtcaattggaccgtgagggcgaggggaca
tgcggctcgataaaagctggctga

DBGET integrated database retrieval system