KEGG   Microvirga ossetica: BB934_25230Help
Entry
BB934_25230       CDS       T05139                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
moc  Microvirga ossetica
Pathway
moc00910  Nitrogen metabolism
moc02010  ABC transporters
Module
moc_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:moc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BB934_25230
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BB934_25230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:moc02000]
    BB934_25230
Transporters [BR:moc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BB934_25230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ANY82057
UniProt: A0A1B2EQ06
LinkDB All DBs
Position
5353904..5354737
Genome map
AA seq 277 aa AA seqDB search
MHPLAPKPVSVLSRAARLGAGIVTQVAPPVLTIALLLLLWQMLASGPTSALPSPLKVIDE
SWDIIVNPFKVGNGIDQGLFWHVSASLVRVGYGYILAAIVGIGVGVLLGQSTLAMRGLDP
VFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSVWPILINTSVGIRNIPQDYRNVAK
VLRLSPIEFFARVMVPATVPHMFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAWNSS
LISDIIVALVYVGVVGFLLDRSIAAIGHLLTRGTAAQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ctgcatccgctggcaccgaagcccgtcagcgttctctcccgtgccgcccggctcggcgcc
ggaatcgtcacacaggtggcaccgccggttctgaccatcgccctcctgctgcttctctgg
cagatgctggcatcgggtcccacttcggcgcttccaagccctctcaaggtgatcgacgag
agctgggacatcatcgtcaacccgttcaaggtcgggaacggcattgaccagggcctgttc
tggcacgtgtcggcctccctcgtccgcgtcggctacggctatatcctcgctgcgatcgtc
ggcatcggagtgggcgtcctgctcggccagtcgacgctcgccatgcgcggcctcgatccg
gtgttccaggttctgcgcaccattcctcctctggcctggctgccgctgtcgctggcggcc
ttccgcgacgggcagccctccgccatcttcgtgatcttcatcaccagcgtctggccgatc
ctgatcaacacctcggtgggcatccgcaacatcccgcaagattatcgcaacgtcgccaag
gtcctgcgcctgtcgccgatcgagttcttcgcgcgcgtcatggtgcccgccactgtgccg
cacatgttcaccggccttcgcatcggcatcggcctgtcatggctcgccatcgtcgcggcc
gagatgctgatcggcggcgtcggcatcggcttcttcatctgggacgcgtggaactcctcg
ctcatctccgacatcatcgtggccctggtctatgtgggcgtcgtcggcttcctgctcgac
cgctccatcgcggccatcggccatctgctcacccgcggcaccgctgcgcagtaa

DBGET integrated database retrieval system