KEGG   Microvirga ossetica: BB934_35070Help
Entry
BB934_35070       CDS       T05139                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
moc  Microvirga ossetica
Pathway
moc00630  Glyoxylate and dicarboxylate metabolism
moc01100  Metabolic pathways
moc01120  Microbial metabolism in diverse environments
moc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:moc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BB934_35070
Enzymes [BR:moc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BB934_35070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ANY83492
UniProt: A0A1B2EUE6
LinkDB All DBs
Position
unnamed3:complement(225332..226624)
Genome map
AA seq 430 aa AA seqDB search
MHVRGHAVSDPTRIEADYLIETTFEPRAAAEAMAGEQSSGTFVPVPGETPELKARSAARI
EALDIQNGEIPQPSLPGSANPKGVADPIRRQARVTLSWPLDNIGPSLPNLVATVAGNLFE
LRQFSGLRLLDMRLPTAFAQGYPGPKFGISGTRRLAGVEALPLIGTIIKPSVGFGPEETA
ALTKTLCEAGIDFIKDDELQSDGPHCPFDERVRAVMRVINDHEDRTGKKVMYAFNLTGEL
DQMRRRHDLVLELGGTCIMASLNSVGLVGMVELGRFSQLPIHAHRNGWGYLSRSPVLGWS
YVAWQKIWRLAGADHMHVNGLQSKFSESDESVITSARACLTPMFADKPCITMPVFSSGQS
AKQAPGTYAGLESADLIVTAGGGIMAHPDGPAAGVSGLREAWEATLAGIPLGDYAREHPA
LAKALEARSA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgagagggcacgctgtgagcgatccgacccgcatcgaggccgattatcttatc
gagacgaccttcgagccccgtgccgcggccgaggcgatggcaggggagcagtcgagcgga
acgttcgtcccagttcccggtgaaactccggagctgaaggcacgatcggcagcccgcatc
gaagcgctggacattcagaacggagagataccacagccttcgcttccaggctcggcaaac
cccaagggcgtggccgatccgatccggcggcaggcgcgcgtcacgctgtcctggccactc
gacaacatcggcccgtcgctgcccaatctggtcgccacggttgcagggaacctgttcgag
ctgcgccagttctcaggcctgcgccttctcgacatgcgcctgcccaccgccttcgcgcag
ggctatccaggcccgaagttcggcatttccgggacgcgccgcctcgccggcgtcgaggct
ctccccctgatcgggaccatcatcaagccaagcgttggttttggacccgaggaaaccgct
gcgctgaccaagaccctgtgcgaagccggcatcgacttcatcaaggacgatgagcttcaa
tccgacggaccacattgtcccttcgacgagcgggtccgcgccgtgatgcgcgtcatcaac
gatcacgaggaccgcacgggcaagaaggtgatgtatgccttcaatctcaccggtgagctc
gatcagatgcggcgtcgccacgatcttgtcctcgagcttggcggcacctgcatcatggcc
agcctcaactcggtgggcctcgtcggcatggtcgaactggggcggttctcgcaactgccg
atccacgcccatcgcaacggctggggctatctctcccgctcgcccgtgttgggttggtct
tacgtcgcctggcaaaagatctggcggctcgcgggcgccgaccacatgcatgtgaatggt
ctgcagagcaaattctcagagtcggacgagagtgtcatcacctcggcccgggcctgcctc
accccgatgtttgcggacaagccttgcatcaccatgccggtcttctcctcgggccaatcc
gccaagcaggcgccgggcacctatgcggggctcgaatcggcggacctgatcgtcacggcg
ggagggggcatcatggctcaccccgatggtcccgccgctggcgtgtcgggcctgcgcgag
gcctgggaggcgaccttggccggcatcccgctcggcgactacgcccgtgagcatcccgcc
ctcgccaaggccttggaggcccgctcagcatga

DBGET integrated database retrieval system