KEGG   Myroides odoratimimus: AS202_05030Help
Entry
AS202_05030       CDS       T04190                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mod  Myroides odoratimimus
Pathway
mod00010  Glycolysis / Gluconeogenesis
mod00053  Ascorbate and aldarate metabolism
mod00071  Fatty acid degradation
mod00280  Valine, leucine and isoleucine degradation
mod00310  Lysine degradation
mod00330  Arginine and proline metabolism
mod00340  Histidine metabolism
mod00380  Tryptophan metabolism
mod00410  beta-Alanine metabolism
mod00561  Glycerolipid metabolism
mod00620  Pyruvate metabolism
mod00625  Chloroalkane and chloroalkene degradation
mod01100  Metabolic pathways
mod01110  Biosynthesis of secondary metabolites
mod01120  Microbial metabolism in diverse environments
mod01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS202_05030
   00053 Ascorbate and aldarate metabolism
    AS202_05030
   00620 Pyruvate metabolism
    AS202_05030
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AS202_05030
   00561 Glycerolipid metabolism
    AS202_05030
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AS202_05030
   00310 Lysine degradation
    AS202_05030
   00330 Arginine and proline metabolism
    AS202_05030
   00340 Histidine metabolism
    AS202_05030
   00380 Tryptophan metabolism
    AS202_05030
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS202_05030
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AS202_05030
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AS202_05030
Enzymes [BR:mod01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AS202_05030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALU25538
UniProt: A0A0S7EDK0
LinkDB All DBs
Position
1100717..1102264
Genome map
AA seq 515 aa AA seqDB search
MTTSNNQFGISEVLEKLGLVAENNGSSTGLNSFSNGRIIESYSPVDGQLIGKVKASTKED
YQKVMATAEEAFKSWRLVPAPKRGEIVRQIGEELRNKKEYLGKLVSYEMGKSLQEGLGEV
QEMIDICDFAVGLSRQLYGLTMHSERPMHRMYEQWHPIGVVGVISAFNFPVAVWSWNTMI
AWVCGDVCIWKPSSKTPLCGVACQNIVAGVFKKNNIPEGVCNLVIGNECGDLINTDPRIP
LVSFTGSTRIGRHVSKTVAERFGNTILELGGNNAIIVSEHADINMVLVGAVFGAVGTAGQ
RCTSTRRLIVHESVYDKTVDVLQKAYAQLKIGNPLDATNHVGPLIDKAAVKDYLDAIEKA
KAEGGKVIVEGGVLEGAGYESGCYVKPCIIEGKNTYEIIQAETFAPILYIMKYKDIEEAI
AMQNGVPQGLSSSIFTNSMREMELFLSHAGSDCGIANVNIGTSGAEIGGAFGGEKETGGG
RESGSDAWKAYMRRQTNTINYGTELPLAQGIKFDF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatctaataaccaatttggtatttcggaagtattagaaaaattaggactcgtg
gcagagaacaatggttcttctacaggtcttaactctttttctaacggtaggattatagaa
tcttattctcctgtagacggtcaacttatcggaaaagtaaaagcttctacaaaagaagat
taccaaaaagtaatggctactgcagaggaggcttttaaaagctggagactagtacctgct
cctaaacgaggcgaaatcgtaagacaaataggtgaagaacttcgaaataaaaaagaatac
ttaggcaagctagtatcatacgagatgggaaaaagccttcaagaaggtctaggtgaggta
caggagatgatcgacatctgtgacttcgcagtaggtctatctcgtcagttatacggacta
acgatgcattctgagcgccctatgcaccgtatgtatgagcagtggcaccctatcggagtg
gtaggtgttatctctgcatttaacttcccggtagcagtatggagttggaataccatgatc
gcatgggtatgtggtgatgtgtgtatctggaaacctagttctaagacaccattatgtggt
gtagcgtgtcagaatatcgtagctggcgtattcaagaaaaacaatatccctgaaggtgta
tgtaacctagttatcggtaatgagtgtggtgatctaatcaacacggatcctagaatccct
ctagtgtcattcacggggtctactcgtataggtagacatgtatctaagactgtagcagaa
cgcttcggtaatactatcctagagcttggaggtaataatgctatcatcgtatctgagcat
gctgatatcaacatggtattagtaggggctgtattcggagctgtaggtactgcaggacag
cgctgtactagtacgagaaggctgatcgtacacgagagcgtatatgataaaacagtagat
gtactacaaaaggcatatgcacaattaaaaatagggaacccattagacgctactaatcac
gtaggaccacttatcgataaagcagctgtaaaagattacttagacgctatagaaaaggca
aaagctgaaggtggtaaggtcatcgtagaaggtggtgtactagaaggtgctgggtatgag
agtggatgttatgtaaaaccgtgtatcatagaaggtaagaatacttacgaaattatacag
gctgagacattcgcacctatcttatacatcatgaagtacaaagatatcgaagaggctatc
gctatgcaaaatggggtgcctcaagggctatcttcttctatcttcacgaatagtatgaga
gaaatggagttattcttatctcatgcaggctctgactgtggtatcgctaatgtgaatatc
ggtacatctggtgctgagatcggaggcgcattcggaggtgaaaaagagactggtggagga
agagagtctgggtcagacgcgtggaaagcttatatgagaagacagacgaatacaatcaac
tatggtacagagctaccattagcacaaggtattaaatttgacttctag

DBGET integrated database retrieval system