KEGG   Myroides odoratimimus: AS202_07940Help
Entry
AS202_07940       CDS       T04190                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mod  Myroides odoratimimus
Pathway
mod00020  Citrate cycle (TCA cycle)
mod00310  Lysine degradation
mod00380  Tryptophan metabolism
mod01100  Metabolic pathways
mod01110  Biosynthesis of secondary metabolites
mod01120  Microbial metabolism in diverse environments
mod01130  Biosynthesis of antibiotics
mod01200  Carbon metabolism
Module
mod_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mod_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mod00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AS202_07940
  Amino acid metabolism
   00310 Lysine degradation
    AS202_07940
   00380 Tryptophan metabolism
    AS202_07940
Enzymes [BR:mod01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AS202_07940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ALU26080
UniProt: A0A0S7E958
LinkDB All DBs
Position
1734096..1736867
Genome map
AA seq 923 aa AA seqDB search
MDRYSFLNAAHTAFFADLYDQYLESPDSVEPSWRAFFQGFDFANEYNGGPVEQLSQAYTS
SNSVGVDSSAQLGQLQKEFAVLKLIDAYRTYGHLLTKTNPLRDRKVEHPDLSLEKFGLSQ
ADLNVNFEAAKTIQLPTTTLGQIIAQLEKIYCTTLGIEYKYITDEAAVQWIQNHYEATEA
KFDSEEKKEILHKLIEAVSFENFLNTKYVGQKRFSLEGLEAAIPAMDFMMDAAAEKGVEE
IVVGMAHRGRLNVLANVFHKPAQDIFAEFDGKDYDAVEGFDGDVKYHLGLTSTRKTRSGK
EIHVNLTPNPSHLETVGAVIEGIARAKQDTIFVNEPSKVLPIALHGDAAIAGQGIVYEIV
QMAKLRGYKTEGTIHIVLNNQVGFTTNYSDGRSSTYSTDVAKVTQSPVLHVNADDTEAAV
RAFLFALDYRMHFGTDVFIDLVGYRKYGHNEGDEPKFTQPILYKLISKHPNSRNIYNARL
LEDKVVDDAFVKSLEKQYKDALEQELSTSREKEFAKVRTFMEENWDGFHIAGRDKMVADY
DTKVSKEKLTAIAEVITALPGDKKFINKVTRLIGDRKAMFFEKDALDWAMGELLAYGTLL
TDGYDVRMSGQDVERGTFSHRHAVVKTEDTEESIILLNQLKEQNGQMRIFNSLLAEYAVL
GFEYGYALTNPNTLTIWEAQFGDFSNGAQIMMDQYISAAEDKWSNQNGIVMLLPHGYENQ
GAEHSSARLERYLQLCAESNMFVTNVTTPANFFHLMRRQMITDFRKPLINMSPKSLLRHP
AAVSSISDFTDGKFQYVIDDANVNAADVKSVVLCSGKFYYDLVAKREELGRKDIAFVRIE
QLFPLPIEQIAEVLAKYTNADDFVWGQEEPRNMGAYGHMLMNFDLKPLRYAGNQAFSAPA
SGSSVRSKKRYAEAIAKVFDKNL
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggatagatattcctttttaaatgcggcacacactgcattttttgcagatttatatgat
caatatttagaaagcccagatagcgtagagccaagctggagagctttctttcagggattt
gactttgcaaatgaatacaatggtgggcctgttgagcaattatcacaagcttatacgtca
agtaatagtgttggtgtagatagttcagcgcagttagggcaacttcaaaaggagtttgct
gtattaaaattaattgacgcttacagaacttatgggcatttattgactaaaacaaaccca
ttaagagacagaaaagtagagcatccagatttgagtttagagaagtttggtctttctcaa
gcagatttgaatgttaattttgaggctgcaaaaacaatacaactaccaactactacattg
ggacaaatcattgcccaattagagaaaatttactgtactacattaggtattgagtacaag
tacatcactgatgaagctgctgtacaatggattcaaaatcattatgaggctacagaggca
aaatttgatagtgaagagaagaaagaaattctgcacaagttaattgaagcagtttctttt
gagaacttcctaaacacaaaatacgttggacaaaaacgtttctcactagaaggtctagaa
gctgcaataccagcgatggactttatgatggacgctgctgctgaaaaaggagtagaagag
atcgtagtagggatggcacaccgtggacgtcttaatgtattagctaacgtattccataaa
cctgcacaagatatctttgctgaatttgacggtaaagattatgatgctgttgaaggtttt
gacggagacgttaagtatcacttaggtcttacatctacacgtaagactcgttctggaaaa
gagatccatgttaacttaactcctaacccttctcacttagagactgtaggggcagttatc
gaaggtatcgctagagcgaaacaagatactatctttgtaaacgaaccatctaaagtttta
cctatcgctcttcacggagatgctgcaatcgctggacaaggaattgtttatgaaattgta
cagatggctaaacttagagggtataagacagaaggtacaattcacattgtattaaacaac
caagttggttttacaactaactattctgatggtcgttcttctacttattctacagatgtt
gctaaagtaactcaatctcctgtattacacgttaacgctgacgatactgaagctgcagta
agagcattcttattcgctttagattaccgtatgcattttggtacagatgtatttattgac
ttagttggataccgtaaatacggacacaacgagggagatgaaccaaagttcactcaacca
atcttgtacaagttaatctctaaacaccctaactctcgtaatatctataacgctagatta
ttagaggataaagtggtagatgatgctttcgttaaatctttagagaaacaatataaagat
gctttagaacaagagttaagcacttctcgtgaaaaagaatttgctaaggttagaacattt
atggaagagaactgggatggattccacatcgcaggtcgtgacaaaatggtagctgactac
gacactaaagtttctaaagagaaattaactgcaattgctgaagtaattactgcattgcct
ggtgataaaaaattcatcaataaggtgacaagacttatcggagatagaaaagctatgttc
ttcgagaaagatgctttagattgggctatgggtgagttattagcgtatggtacattattg
acagatggatacgatgtgcgtatgtcaggtcaagatgtagagcgtggtacattctctcac
agacatgctgtagtgaaaacagaagatacagaagagtcaatcatcttattaaaccaatta
aaagagcaaaacggtcaaatgagaatattcaactctctattggctgagtacgctgtttta
ggttttgagtatggttatgcattgactaatcctaatacattaactatctgggaagcacag
ttcggggatttctctaacggagctcagattatgatggatcaatatatctctgctgctgaa
gataaatggagcaaccagaacggtatcgtgatgttattacctcacggatatgagaatcaa
ggtgctgaacactcttctgctagattagagcgttacttacagttatgtgctgaaagtaat
atgttcgtaacgaatgtaactactccagcgaacttcttccacttaatgagaagacaaatg
atcactgactttagaaagccattaatcaatatgtctcctaagagtttattaagacaccca
gctgcggtatcttctatcagtgactttacagatggtaaattccaatacgtgatagacgat
gctaatgtaaatgctgcagatgtaaaatcagtagtattgtgtagtggtaagttctactac
gacttagtagctaagcgtgaagaattaggtagaaaggatattgcatttgttcgtatcgaa
caattattcccattaccaatcgaacaaattgctgaggtattagcgaagtatactaatgca
gacgacttcgtatggggtcaagaagagccacgtaacatgggtgcttatgggcatatgtta
atgaactttgacttgaaaccattgcgttatgcaggtaaccaagcatttagtgcaccagct
tcaggaagttctgtacgttctaaaaaacgttatgcagaagctatcgcaaaagtgttcgac
aagaatttataa

DBGET integrated database retrieval system