KEGG   Myroides odoratimimus: AS202_08940Help
Entry
AS202_08940       CDS       T04190                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
mod  Myroides odoratimimus
Pathway
mod00380  Tryptophan metabolism
mod01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mod00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AS202_08940
Enzymes [BR:mod01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AS202_08940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase Hfx_Cass5
Motif
Other DBs
NCBI-ProteinID: ALU26266
UniProt: A0A0S7EIE1
LinkDB All DBs
Position
1973606..1974883
Genome map
AA seq 425 aa AA seqDB search
MSFENTLAYAKSLDEKDPLAKYRDEFNFPEVNGKQVIYFTGNSLGLQPKRAVEYVNEVMN
DWGALAVEGHFYAEKPWWDYHERLSEPLSRIVGAKSSEITVMNTLTVNLHLLMTTFYRPT
ASKYKIICEEKAFPSDQYLIQSQVRLHGLDPKEAIIELKKRPGEHNFRLEDILEKIDEVG
EEVALVLIGGLNYYTGQVFDIQTITAHAHQYGAKVGWDLAHAAGNIELKLHEWNVDFAAW
CSYKYMNAGPGSASGCFIHERYHTDKDLVRLAGWWGHNKERRFLMEKKFDAVESAHGWQI
SNPSILSLAPYLASIEMFDEVGMEALITKQRKITAYLEFVMEDVAKAVNANYELITPKEE
SERGSQLSVFLHGKGKDLFSYLMNEGVIVDWREPNVVRLAPVPFYTSYEDIYRFGEILKK
ADSLF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgaaaatacacttgcttatgcaaagagcttagatgaaaaagatcctttagct
aagtacagagatgagtttaactttccagaggtgaatggaaaacaggttatatattttaca
ggtaattcgctgggactacaacccaaaagagctgtagagtatgtcaatgaggttatgaat
gattggggggctttagcagtagaggggcatttctacgcagagaaaccttggtgggattac
cacgaacgtttaagtgaaccattgagtagaatagtaggagcgaagtcgtcagaaattacg
gtgatgaatacattgactgttaatcttcacttattgatgactactttttatcgtcctact
gctagtaagtataagattatatgtgaggaaaaagcatttccgagtgatcaatatctgata
cagtctcaggtaagattacatgggctagatcctaaagaggctattatagagttaaagaaa
agaccaggagaacataactttagactagaggatatattagaaaagatagatgaagtagga
gaagaggttgctttagtgttaataggaggacttaactattatacaggtcaagtgttcgat
attcaaactatcacagcccatgcgcatcaatatggagctaaggtaggttgggatttagct
catgctgctggtaatatagagttgaagttgcacgagtggaatgtagatttcgctgcatgg
tgtagttataaatatatgaatgctggaccaggtagtgcatcaggctgtttcattcatgaa
cgttaccatacagataaagatttagtaagattagctggatggtggggacataataaagaa
cgtcgtttcttaatggagaaaaaatttgatgcagtagagagtgcacatggatggcaaatt
agtaatccttctattcttagcttagctccctatttagcatctatagagatgttcgatgaa
gtgggtatggaggctttgataacaaaacaaagaaagattactgcttatcttgaatttgta
atggaagatgtagctaaagctgttaatgctaattatgagttaattacgcctaaggaagaa
agtgagagaggaagccaactttctgtatttcttcatggaaaaggtaaagatttgttttcg
tatttaatgaatgaaggagtaatcgtagactggagagaacctaatgtagttaggttagca
ccagtgccattttatacttcttatgaagatatatatcgtttcggagagattctaaaaaag
gcagatagtcttttttag

DBGET integrated database retrieval system