KEGG   Moraxella ovis: MOVS_00455Help
Entry
MOVS_00455        CDS       T04329                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
moi  Moraxella ovis
Pathway
moi00071  Fatty acid degradation
moi00280  Valine, leucine and isoleucine degradation
moi00281  Geraniol degradation
moi00310  Lysine degradation
moi00362  Benzoate degradation
moi00380  Tryptophan metabolism
moi00410  beta-Alanine metabolism
moi00640  Propanoate metabolism
moi00650  Butanoate metabolism
moi00903  Limonene and pinene degradation
moi00930  Caprolactam degradation
moi01100  Metabolic pathways
moi01110  Biosynthesis of secondary metabolites
moi01120  Microbial metabolism in diverse environments
moi01130  Biosynthesis of antibiotics
moi01200  Carbon metabolism
moi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:moi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MOVS_00455 (fadB)
   00650 Butanoate metabolism
    MOVS_00455 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MOVS_00455 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MOVS_00455 (fadB)
   00310 Lysine degradation
    MOVS_00455 (fadB)
   00380 Tryptophan metabolism
    MOVS_00455 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MOVS_00455 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MOVS_00455 (fadB)
   00281 Geraniol degradation
    MOVS_00455 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MOVS_00455 (fadB)
   00930 Caprolactam degradation
    MOVS_00455 (fadB)
Enzymes [BR:moi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MOVS_00455 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MOVS_00455 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MOVS_00455 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     MOVS_00455 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ANB90728
UniProt: A0A378PJ46
LinkDB All DBs
Position
99580..101730
Genome map
AA seq 716 aa AA seqDB search
MIYQGKSIQVSRLDGDIVKFHFNNENESVNKFDQATNAEFKEAVTALEQDTNIKGLIVTS
GKKVFIAGADITEFVGYFKNPQEELENWLLDINSVFNRFEDLPFPKVSAINGAALGGGCE
MTLVCEYRVMGQSAQIGLPETKLGIFPGFGGSVRTPRIIGIDNALELIATGNPLKPNDAL
KVGLVDAVVADESVEQSALDLVKKCINCELDWQAKRAEKLEPVKLNQTEQAMAFNSAKGV
IFAKANPKHYPAVALALDAIENHVNLGRDEAIKIEATNFAKSAKTPQAAALVGVFLNDQL
VKKRAKDQSKSAHDINEMAVLGAGIMGGGIAYQSAVKGLPIIMKDIKAEQLDLGMNEASK
LLSKEVERGKISTAKMGETLSKIRPTLNYGDFATPDIVIEAVVENEKIKKAVLAETENLI
KDTAILASNTSTISITELAKSLKRPENFVGMHFFNPVHRMPLVEIIRGEQTSDEAVATTV
ALAQKMGKTPIVVNDCAGFLVNRVLFPYFGAFDLLIKHGADFVKIDKVMEKFGWPMGPAY
LLDVVGIDTGVHASSVMAEAFPERMNPDYKSATTVMFENNRLGQKNGAGFYNYELDKKGK
PKKSVDTTTYELLKAVQDGHVDFDEQEIIDRLMVAFCTETVRCLEDSIVASAGEADMAML
MGLGFPPFRGGPCRYIDQVGVKEFVALCDKYAHLGKAYEAPQLLRDMAERGESFYQ
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaggaaaatccatacaagtcagccgactagacggcgatatcgtcaaattt
catttcaataatgaaaatgaatcagtcaataaatttgaccaagccaccaatgctgagttc
aaagaagccgtaaccgccttggagcaggacacgaacatcaagggcttgattgtaacgtca
ggcaaaaaggtctttatcgcaggggcggatattaccgagtttgtcggttattttaaaaac
ccccaagaagaattggaaaattggctacttgacattaacagtgtgtttaaccgttttgaa
gatttaccatttcctaaggtgtcggctatcaatggcgcagcgttgggaggtgggtgcgag
atgacccttgtgtgtgagtaccgtgtcatggggcaatcggctcagattggcttgcctgag
accaaactcggtattttccctggctttggtggtagtgtgcgtacgccacgcattatcggc
attgacaacgccctagaactcatcgccacaggcaatcccctaaaacctaacgatgcccta
aaagtgggtttggtggacgctgtcgtggcggacgagagtgtggagcagtcggctctggat
ttggtcaaaaagtgcataaattgcgagcttgactggcaagccaaacgtgccgagaagtta
gaacctgtcaaacttaaccaaaccgagcaggcaatggcgtttaactctgccaaaggcgtg
atttttgccaaagccaatcccaagcattatcctgccgttgcccttgccctagatgcgata
gaaaaccacgttaatttggggcgtgatgaagcgattaagattgaagcgaccaattttgcc
aaatccgccaaaaccccacaagcggctgctcttgtcggtgtatttctaaacgaccagctg
gttaaaaaacgtgccaaagaccaatccaaatccgcccacgacatcaatgaaatggcggtg
cttggggcagggattatgggcggtggtatcgcttatcaatcggcggtcaagggcttgccc
atcatcatgaaagacatcaaggcagaacaacttgacctaggcatgaatgaagcaagcaag
ctccttagcaaagaagtagaacgtggcaaaattagcaccgccaaaatgggcgaaacccta
tctaaaatccgcccaaccctaaactatggtgattttgctacgcctgacatcgtcattgaa
gcggtggtggagaacgaaaaaatcaaaaaagcggtgcttgccgagaccgaaaacctcatc
aaggacacggctatccttgcgtccaacacgtccacgattagcattaccgagcttgccaag
tcgctaaaacgccccgagaattttgtgggtatgcacttttttaaccctgttcatcgcatg
ccccttgtggagattatccgtggcgagcagacgagcgatgaagcggtggcgaccacggtt
gcccttgctcaaaagatgggcaaaacgccaattgtggtcaatgactgtgcaggatttttg
gtaaaccgtgtgctgttcccttattttggggcgtttgatttactcatcaaacacggggcg
gattttgtcaagattgataaagtcatggaaaagttcggctggcctatgggacctgcctat
ctgcttgacgttgtgggcattgatacaggcgtgcacgcaagttcggtcatggcggaggct
ttccctgagcgtatgaaccctgattataagagtgccacgactgtcatgtttgaaaataac
cgtctaggtcaaaaaaatggcgcaggcttttataactatgagcttgacaaaaaaggcaag
cctaaaaagagcgtggatacgaccacttatgagctactaaaggcggtgcaagatggtcat
gtcgattttgacgagcaagaaatcattgaccgcttaatggtggcgttttgtaccgagacg
gtacgttgcctagaagatagcatcgtggcaagtgcaggcgaggcggatatggcaatgctc
atggggcttggtttcccaccgtttcgtggtggtccgtgtcgctacattgaccaagtgggc
gtaaaagaatttgtcgccttgtgcgataaatacgctcatctgggtaaggcgtatgaagct
ccgcaactcttgcgagacatggcagagcgtggcgagagtttttatcaataa

DBGET integrated database retrieval system