KEGG   Moraxella ovis: MOVS_04000Help
Entry
MOVS_04000        CDS       T04329                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
moi  Moraxella ovis
Pathway
moi00061  Fatty acid biosynthesis
moi00780  Biotin metabolism
moi01100  Metabolic pathways
moi01130  Biosynthesis of antibiotics
moi01212  Fatty acid metabolism
Module
moi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:moi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MOVS_04000
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MOVS_04000
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    MOVS_04000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:moi01004]
    MOVS_04000
Enzymes [BR:moi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     MOVS_04000
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     MOVS_04000
Lipid biosynthesis proteins [BR:moi01004]
 Fatty acid synthase
  Component type
   MOVS_04000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR CBM_25 Acetyltransf_1
Motif
Other DBs
NCBI-ProteinID: ANB91279
UniProt: A0A378PJ95
LinkDB All DBs
Position
825591..826412
Genome map
AA seq 273 aa AA seqDB search
MLLKGQRFVVTGIASKLSIAWAIAESLHREGAELILTYPNDKIKKRVDMAAEAFGATAVI
ECDVGSDASIEACFNEINQLWGQGEDRGVNGIVHAIGFAPADQLDGDFTNATTREGSSIA
HDISSYSFVALAKAGRELLAARQGSLLTLTYEGSISVLPNYNVMGMAKASLEASVRYLAS
SLGGEGIRVNAISAGPIRTLAASGIKSFRRMLDVSEKIAPLQRNVSQEEVGNAALFLLSP
WASGVTGEILFVDAGFNTVAISEQIMAMAGDDE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaaaaggccagcgttttgtggtaacgggcatcgccagtaagctttctatcgct
tgggcgatcgctgagagtttgcatcgtgaaggtgctgagctgatcttgacctacccaaat
gacaaaatcaaaaaacgtgttgacatggcggcagaagccttcggtgcaactgcggtaatc
gagtgtgacgtaggttctgatgcatctatcgaagcatgttttaatgaaattaatcagctt
tggggtcagggtgaagataggggtgtaaacggcatcgtgcatgcgattggttttgctcct
gctgatcagctggatggtgattttaccaatgctaccacgcgtgaaggctctagcattgcg
cacgacatctcaagctatagctttgtggcacttgccaaagcgggtcgtgaactactggct
gcacgccaaggttcgctactaaccctaacttatgaaggtagtatctctgtactaccaaac
tataatgtcatgggcatggcgaaggcaagtttggaggcgtctgtgcgctatctagcaagc
tcgttgggtggtgagggcatccgtgtgaacgccatcagtgcaggtccgattcgcacattg
gcagccagcggtatcaaatcattccgtcgcatgctagacgtaagcgaaaaaatcgctccg
ttacaacgcaacgtcagccaagaagaagtgggtaatgccgcactattcttattgtctcct
tgggcgagcggtgtgacaggtgagattttattcgtggatgcgggctttaataccgtcgcc
atcagcgaacaaatcatggcaatggcaggagatgacgaataa

DBGET integrated database retrieval system