KEGG   Moraxella ovis: MOVS_05295Help
Entry
MOVS_05295        CDS       T04329                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
moi  Moraxella ovis
Pathway
moi00061  Fatty acid biosynthesis
moi00620  Pyruvate metabolism
moi00640  Propanoate metabolism
moi01100  Metabolic pathways
moi01110  Biosynthesis of secondary metabolites
moi01120  Microbial metabolism in diverse environments
moi01130  Biosynthesis of antibiotics
moi01200  Carbon metabolism
moi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:moi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MOVS_05295
   00640 Propanoate metabolism
    MOVS_05295
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MOVS_05295
Enzymes [BR:moi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     MOVS_05295
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MOVS_05295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: ANB91493
UniProt: A0A378PK24
LinkDB All DBs
Position
complement(1133458..1134810)
Genome map
AA seq 450 aa AA seqDB search
MIKKLLIANRGEIALRIVRACKQLGISTVGVYSTADKDLMHLRFVDEAVCIGNAPSSQSY
LDVNAILSAAEVTGADAIHPGYGFLSENADFAEKVEEAGLTFVGPHADHIRLMGNKVSAI
NAMKKAGVPTVPGSVGAITLHNAEEQAKNIGFPLIVKAAAGGGGRGMRVVERFEELINQV
QAAKAEAESAFGDDTVYMERFLKNPRHVEVQVLGDGNGNALHLFDRDCSLQRRHQKVLEE
APAPGIPDDIRQPILDACVRACEQIKYRGAGTFEFLYEDGQFFFIEMNTRVQVEHPVTEM
ITGIDIIVEQLKIAAGYGLSYHQDEITIRGHAIECRINAEDPKTFMPCPGKIENLFAPSG
SGVRFDSHLYQGYNIPSYYDSMIGKLICHAQTRSQAVAKTLHALDELIIEGIKTNIPLHR
DVILQDENFVNEAQNIHYLENHLLKPQDSK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaactattgattgcaaaccgtggtgagatcgccctgcgcatcgtacgtgcc
tgtaagcagctgggcatctctaccgtgggcgtgtactcgacagccgataaagatctcatg
cacctgcgattcgtagatgaggcggtatgcatcggtaacgccccttcttcgcaaagttat
cttgacgtgaatgccatcctatcagctgctgaagtgactggcgcggatgcgattcaccct
ggttatggttttttgtcggagaatgctgacttcgctgagaaagtagaagaagcgggccta
accttcgtgggtcctcatgctgatcacattcgcctaatgggtaacaaagtatcagccatt
aacgccatgaaaaaagcgggcgtgccgactgtgccaggctctgttggcgcaatcactcta
cacaacgccgaagagcaggctaagaacatcggctttccgctgatcgtaaaagcagcagct
ggcggtggtggtcgtggcatgcgtgtggtagaacgcttcgaagaactcatcaaccaagta
caagctgccaaggcagaggctgaaagcgcctttggtgatgataccgtatatatggagcga
ttcttaaagaaccctcgccatgtcgaggttcaggtacttggcgatggtaatggtaatgcc
ctacacctgttcgatcgtgactgctcgctacagcgccgccaccaaaaagtactagaagaa
gcgccagcacctggcattcctgatgacatcagacagccaattctagatgcgtgcgtgcgt
gcttgtgagcagattaagtatcgcggtgcgggcacctttgagtttctatatgaagacggt
caattcttctttattgagatgaatacacgtgttcaggtagaacaccctgttactgagatg
attacaggcatcgacatcatcgttgagcaattaaaaatcgccgcaggttatggactgtct
tatcatcaagacgagatcaccatccgcggtcatgccatcgaatgccgtatcaatgcggaa
gatcctaagactttcatgccctgccctggcaagatcgaaaatctgttcgcaccaagcggt
tctggcgtacgctttgatagtcatctgtatcaagggtataacatccctagctactatgac
tcaatgattggtaagctgatctgccatgcgcaaacacgcagtcaagccgttgcaaagaca
ttgcacgcattggatgagctgatcatcgaaggcatcaagaccaacattccactacatcgc
gatgtcattctccaagatgagaattttgttaatgaagcacaaaacattcattatctagaa
aatcatctactaaaaccacaagacagcaaataa

DBGET integrated database retrieval system