KEGG   Moraxella ovis: MOVS_05535Help
Entry
MOVS_05535        CDS       T04329                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
moi  Moraxella ovis
Pathway
moi00030  Pentose phosphate pathway
moi01100  Metabolic pathways
moi01110  Biosynthesis of secondary metabolites
moi01120  Microbial metabolism in diverse environments
moi01130  Biosynthesis of antibiotics
moi01200  Carbon metabolism
moi01230  Biosynthesis of amino acids
Module
moi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:moi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MOVS_05535
Enzymes [BR:moi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MOVS_05535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ANB91534
UniProt: A0A378PK74
LinkDB All DBs
Position
complement(1188725..1189390)
Genome map
AA seq 221 aa AA seqDB search
MTTVDPKLTQKQAAAKAALSYIEDGMILGVGTGSTVNCLIELLADVRLKGAVSSSKVTED
KLRALGIEIFDLNTVGELDLYIDGADEIDAQGNMIKGGGGALTREKIVAAASKSFVCMVD
DSKVVQKLGKFPVAIEVLPQARSYVARELVKLGGDPVYREGFVTDYGNVILDTYDLDISN
PDEFEKTLNNIVGVVCNGIFAAQSANIMLKAGDEGVDTVRF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagtcgatccaaaactcacccaaaaacaagccgctgccaaagccgccttaagc
tacatcgaagatggcatgattttaggtgttggcacgggcagcacggtgaattgcttgatt
gagttattggcagatgttcgactaaaaggcgcagtatcatcatctaaagtcaccgaagat
aagcttcgcgctttaggcattgagatttttgatctaaacactgtgggtgagcttgatctg
tatatcgatggtgcagatgagattgatgcgcagggcaacatgatcaaaggcggtggcggt
gcgcttacacgcgaaaaaattgtcgcagcagcttccaagtcttttgtgtgcatggttgat
gattctaaggtcgtgcaaaagcttggcaaattcccagttgcaatagaagtcttgccacag
gcgcgatcatacgttgccagagagctggtcaagttaggcggtgatccggtctatcgtgaa
ggatttgttaccgattatggcaatgtgattttggacacttatgatttggacatcagtaac
cctgacgaatttgaaaagacgctaaataacatcgttggcgtggtctgtaatggcatcttt
gcagcgcagtcagcgaacatcatgctaaaggcaggcgacgaaggcgtggataccgtacgg
ttttaa

DBGET integrated database retrieval system