KEGG   Methanothermococcus okinawensis: Metok_0234Help
Entry
Metok_0234        CDS       T01534                                 

Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mok00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Metok_0234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mok01007]
    Metok_0234
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mok03016]
    Metok_0234
Enzymes [BR:mok01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     Metok_0234
Amino acid related enzymes [BR:mok01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Metok_0234
Transfer RNA biogenesis [BR:mok03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Metok_0234
 Prokaryotic type
    Metok_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His HGTP_anticodon tRNA-synt_2b tRNA-synt_2 tRNA-synt_2d DUF4919
Motif
Other DBs
NCBI-ProteinID: AEH06227
UniProt: F8ANM9
LinkDB All DBs
Position
250871..252118
Genome map
AA seq 415 aa AA seqDB search
MFKKPKGTRDFTPLEMKKRRIIENKLRNVFDSYNFKEINTPTFESFELLSKKTGEDIRKQ
LFVFKDHGNREMGLRPELTSSVVRFYINELKNLPKPLKLYYFANCFRYENPQAGRYREFW
QMGCELIGSKYPIADAEIINLAMDGLNKIDMDYEINIGHLGVLRGIFKEFNLSEDEELKI
RRLIDKEDYKGLENYLSEIKSSDELRDIIFKILNSKGDKSVISDLKEVLKDYPTSIEAMN
NLEEILEFVKHDNIVVNFGIARGLDYYTGMVFEIYGKKEGARQVCGGGRYDNLIELFGEK
PTPAVGFAYGFDRVMLNIDDFEVEDESILIIPIKKDKKLLKECLNIADVLRKSGKSVEIE
LMNRKLNKALNYANAVGINKVIIVGEQELSKGKVSLKNMKTGEQELVGLDELENI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaccaaaaggaacaagagactttacacccttagaaatgaaaaagagaaga
atcatcgagaacaaattaagaaatgtatttgacagctacaattttaaggaaataaacacc
ccgacttttgaaagtttcgagctcctatctaaaaaaactggtgaagatataagaaaacag
ttatttgttttcaaagaccatggaaacagggagatgggacttagacctgagctcacatca
tcggtagtaagattctatataaatgagcttaaaaaccttccaaagccgttaaaattatac
tattttgcaaactgttttagatacgagaacccacaggctgggagatatagggaattttgg
cagatgggctgtgaattgataggcagtaaatatccaatagcagatgcagagattataaat
ttggcaatggatggacttaataaaatagatatggattatgaaataaatataggtcattta
ggggtgttaaggggaatatttaaagaatttaatctctcagaggatgaggaattaaaaata
aggagattgattgataaggaagattacaaaggtcttgaaaattatctctccgaaattaaa
tcatccgatgaattgagggatataatatttaaaatattaaattcaaaaggagataaatca
gtaatatctgatttaaaggaagttttaaaggattatccaacatcaattgaagcaatgaat
aatttggaggaaatcttagaatttgtaaaacatgataatattgtagtaaatttcggtata
gcaagaggattggattattatacaggaatggtgtttgaaatctacggaaagaaggaagga
gctcggcaggtgtgtggtggtggaagatatgataatttaatagaattatttggagaaaag
cctacgccagcagttggttttgcctatggatttgacagggttatgctaaatattgatgat
tttgaagttgaagatgaaagcatattaataataccaattaaaaaagataaaaaactttta
aaggagtgtttaaatattgcagatgtgcttagaaaaagtggaaaaagcgtagaaattgaa
ttaatgaacagaaaattaaacaaagctttaaattatgccaatgccgttggaattaacaag
gtaataatcgttggtgagcaggagctcagtaaaggtaaagtttcattgaagaatatgaaa
acaggtgaacaggagctcgtgggtttagacgagttggaaaatatttaa

DBGET integrated database retrieval system