KEGG   Methanothermococcus okinawensis: Metok_0256Help
Entry
Metok_0256        CDS       T01534                                 

Definition
(GenBank) Type II site-specific deoxyribonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
mok  Methanothermococcus okinawensis
Brite
Enzymes [BR:mok01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     Metok_0256
Prokaryotic defense system [BR:mok02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    Metok_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII Cast
Motif
Other DBs
NCBI-ProteinID: AEH06248
UniProt: F8ANQ0
LinkDB All DBs
Position
276834..277706
Genome map
AA seq 290 aa AA seqDB search
MDFEYIINNLLDTIKTYDFFVDWNKVENNVKKIEKRLCILNYLIGKENFKGEFFGLLKEY
PEVITVFPILIAVRDDEIKILNENVEVEDLDFKEKSNLSDKEIERYYEFFKKSGLEELLK
NKKIKNLVDYVFGVEVGMDTNARKNRTGKIMENIVEKYIMENLANHKELEYIPQATKNKI
KHKWRIDLILDKTNRKFDFALYNKNTKILYLIEVNFYSGGGSKLKSTAGEYETLNEFIHN
NNKNVKFIWITDGKGWTTAKNPLNESFNSGVTILNLKMIKDGILKDIVLK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaatatattattaataatttgcttgatacgataaaaacttatgattttttt
gttgattggaataaagttgaaaataatgtaaaaaagatagaaaagagattatgtatctta
aactatctaattggaaaagaaaactttaaaggagaattttttggattattaaaagaatat
ccagaagttattaccgtttttccaatattaatagctgtaagagatgatgaaataaaaata
ttaaatgagaatgtggaagttgaagatttggattttaaagaaaaaagtaatttatcggat
aaagaaattgaaagatattatgaattttttaaaaaaagtggattggaggagctattaaaa
aataaaaaaataaaaaatttagtagattatgtttttggtgttgaggtaggtatggatacc
aatgcaagaaaaaacaggactggtaaaataatggaaaatatagttgaaaaatatattatg
gaaaatttagcaaatcataaagaattagagtatatacctcaagccactaaaaataaaata
aaacataaatggaggatagatttaatattagataaaacaaatagaaaatttgattttgca
ttatacaacaaaaatactaaaatattatacctcatcgaagttaatttttatagtgggggc
ggttcaaaattaaaatcaacagcgggagagtatgaaacactaaatgagtttatacataac
aacaataaaaatgttaaatttatatggataactgatggtaagggatggactactgctaaa
aacccattaaatgagagtttcaatagtggtgtgacaatattaaatttaaaaatgattaag
gacggaatattgaaagatatagttttaaagtag

DBGET integrated database retrieval system