KEGG   Methanothermococcus okinawensis: Metok_0345Help
Entry
Metok_0345        CDS       T01534                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00790  Folate biosynthesis
mok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mok00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Metok_0345
Enzymes [BR:mok01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     Metok_0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2 HD_2
Motif
Other DBs
NCBI-ProteinID: AEH06334
UniProt: F8AKD4
LinkDB All DBs
Position
362184..362951
Genome map
AA seq 255 aa AA seqDB search
MQNNLKNNLKMEKSERKRYTINDLFELAEKIENKDLRDKVINFIKNPLPTHKDIEDTHIS
LEDSPASIKWHHKYEGGLIEHILAVTKMALKMAEALEDVYGLNINKNLIIAGGLLHDIMK
PQNYIENDETKKYDHIPNFHLEHLTLAVAELYKQGFPMELIKIVASHHGEYGAMKPDSIE
GWLLHYADNIDASLNDIAIRICQARARDMGIDENEIYKAFTPLKLYEKRTKDGKEKLKDE
LNEIFGNTDEYDDEE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataacttaaaaaataacttaaaaatggagaaatctgaaagaaaacggtatact
ataaatgatttatttgaattggcagaaaaaatagaaaataaagatttaagggataaagtt
ataaactttataaaaaatcctcttcccactcataaagatattgaagatacgcatatatct
cttgaagactctccagctagtataaaatggcatcataaatatgagggagggttaattgaa
cacatattggcagtcacgaaaatggcattaaagatggctgaagctcttgaagatgtgtat
ggtttgaatataaataagaatttaataatagcgggaggattacttcacgatattatgaaa
ccacaaaattatattgaaaatgatgaaacaaaaaaatatgaccatataccaaatttccat
ttggagcatcttaccttggcagttgcagagctctataaacaggggtttcccatggagctc
ataaaaatagtagcttcccatcatggagaatatggagctatgaaaccagattcaatagag
ggatggttgttgcattatgcagataacatagacgcctctttgaacgatattgccataaga
atctgtcaggcaagggctagagatatgggtattgatgaaaatgaaatatataaggcattt
acgccattaaaactatatgaaaagagaacaaaagatggaaaagaaaaattaaaggatgaa
ttaaatgaaatctttggaaatactgatgaatatgacgatgaagaataa

DBGET integrated database retrieval system