KEGG   Methanothermococcus okinawensis: Metok_0719Help
Entry
Metok_0719        CDS       T01534                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00630  Glyoxylate and dicarboxylate metabolism
mok01100  Metabolic pathways
mok01120  Microbial metabolism in diverse environments
mok01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Metok_0719
Enzymes [BR:mok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Metok_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEH06696
UniProt: F8AM17
LinkDB All DBs
Position
737769..739046
Genome map
AA seq 425 aa AA seqDB search
MDYLELGYEPKDNELLSCMVVKAENLKKAANDIAGESSIGTWTELKTMKSEIYKKLKPRV
YEINEMGKEGDTNIGLIKIAYPLDTFEPNNMPGTLAGIAGNIFGMKSLNGLRILDFRFPK
EFIKCYSGPKYGIKGIRKLLNVMERPLVGTIVKPKVGLNSEEHAKVAYNSWIGGCDIVKD
DENLVSQDFNKFEGRLHKVLECRDKAESETGEKKIYMPNITAPYREMVRRAELVEDAGCE
YAMIDVVVLGFSAVQQIREEGFNFAIHAHRAMHAAITRSREWGISMLALAKIYRLLGVDQ
LHIGTVVGKMEGGKDEVCSIRDEIVLEDVKEDNKNKFFNQKWHGLNNTFPVSSGGVYPKL
VPEIVNIFGKDVIIQAGGGIHGHPEGTVAGARAMRASVEASIEGIPLSEKAEEVSELKKA
LEYWK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagaactaggatatgaaccaaaagacaacgaactactttcatgcatggtt
gtaaaagctgaaaatcttaaaaaagctgcgaatgatattgcaggtgagagctctattgga
acatggaccgaattaaaaacaatgaaaagcgaaatatataaaaaacttaaaccaagggta
tatgaaataaatgagatgggaaaagagggggatactaatattggattgataaaaatagcc
tatccattagatacatttgaaccaaataacatgccgggaactcttgcaggaatagcagga
aatatttttggaatgaagtcattaaatggattaaggatattagatttcaggtttccaaaa
gaatttataaaatgttattctggaccaaaatatggaataaaaggcataagaaagctattg
aatgtaatggaaagacccttggttggaacaatagttaaaccaaaagttggattgaattcc
gaagaacatgcaaaagtggcatacaactcatggattggtggttgcgatatagtaaaggac
gatgaaaatcttgtttcacaggattttaacaaatttgaaggcagattgcataaagtgttg
gagtgtagggataaggcagagtctgaaactggtgaaaagaaaatatacatgccaaacatc
acagcaccatatagggaaatggtaaggcgggctgagctcgtagaggatgcaggatgtgag
tatgctatgattgatgttgtggtgcttggattttcagcagttcagcagattagggaggaa
ggttttaattttgcaattcatgcccatagggcaatgcatgcggcaattactcgttccaga
gaatggggtatatcaatgcttgcacttgcaaaaatatacagattgttgggtgttgaccaa
cttcatattggaacagttgttgggaagatggaaggaggcaaagatgaggtatgcagtata
agggatgaaatagtattggaagatgttaaagaggataataaaaataaattctttaaccaa
aaatggcatgggttaaataatacatttccagtatcatcaggaggggtttatcctaaatta
gttccagaaattgtaaatatctttggaaaggatgtaattattcaggcaggaggtggtatc
catggacatccagagggcactgttgcaggagctcgggcaatgagggcatctgttgaggca
tctattgaaggtatcccactgagtgaaaaagcagaagaagtttcagaacttaaaaaagca
ttagaatattggaaataa

DBGET integrated database retrieval system