KEGG   Methanothermococcus okinawensis: Metok_1525Help
Entry
Metok_1525        CDS       T01534                                 

Definition
(GenBank) Prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mok01100  Metabolic pathways
mok01110  Biosynthesis of secondary metabolites
mok01130  Biosynthesis of antibiotics
mok01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metok_1525
Enzymes [BR:mok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Metok_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT SLT_2
Motif
Other DBs
NCBI-ProteinID: AEH07488
UniProt: F8AKG2
LinkDB All DBs
Position
1564055..1564921
Genome map
AA seq 288 aa AA seqDB search
MIYCLGPKGSYSGQAAAIFSKLINDKDIIYCNSIYEVFELVDRKKGSDNIYGVVPSENSI
EGSVSLTQDLLLEFPVKIYGEVNIDIHHCLIGYDKNKIKKVLSHPQALAQCRNYIKKHGW
EAIPVLSTAKAVEKVFEWKNEEYGAIASKESAELYNLKVLDEDIQDYPNNTTRFILIGNE
HESLECKNTQIDNYKNINNNYQKYQNNKKSTIIIELKENKPGALYKVLKEFNNRSINLTR
IESRPSKRKLGNYIFYIDYETPKDEDELLQSLKKHVSYIKYLGSYNVF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatttattgtttaggtcctaaggggagttatagcggacaggcagcagctatattttca
aaactaataaatgataaagatattatttattgtaattctatatatgaagttttcgagctc
gtggataggaaaaaaggaagcgataacatctatggagtagttccttctgagaattccata
gagggttctgtatctttaacacaggatttacttttagaattccctgtcaaaatatacggg
gaggtaaatattgatatacaccactgtttaattggatacgataaaaataaaataaaaaaa
gtgttatcacatccacaggcattggcacagtgtagaaactatataaaaaaacatggatgg
gaagccataccagttttaagtactgcaaaagccgttgaaaaagtatttgaatggaaaaat
gaggaatatggagcaatagcttcaaaagaatctgcggaattatataatttaaaagtgctt
gatgaagatattcaggactaccctaataacacaacgagatttattttaattggaaatgaa
catgaatctttggaatgcaaaaatacacaaattgataattataaaaatatcaacaataac
tatcaaaaatatcaaaataataaaaaatctacaataataattgaattaaaagaaaataag
cccggtgctttatataaagttttaaaagagtttaataaccgcagtattaatttaacaaga
atagaatcaagaccttcaaaaagaaaacttgggaattatatattctacatagattatgaa
actccaaaggatgaagatgagctcctacaatcgttgaaaaaacatgtttcatatataaag
tatttaggaagttataatgttttttaa

DBGET integrated database retrieval system