KEGG   Monaibacterium sp. ALG8: G8E03_15160
Entry
G8E03_15160       CDS       T06480                                 

Definition
(GenBank) alpha/beta fold hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
mon  Monaibacterium sp. ALG8
Pathway
mon00362  Benzoate degradation
mon00622  Xylene degradation
mon00643  Styrene degradation
mon01100  Metabolic pathways
mon01120  Microbial metabolism in diverse environments
mon01220  Degradation of aromatic compounds
Module
mon_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:mon00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    G8E03_15160
   00622 Xylene degradation
    G8E03_15160
   00643 Styrene degradation
    G8E03_15160
Enzymes [BR:mon01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     G8E03_15160
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Abhydrolase_4 AXE1
Other DBs
NCBI-ProteinID: QIK42241
LinkDB
Position
unnamed2:complement(31593..32417)
AA seq 274 aa
MMSNPEIGKTIKAAGRDTNYLEEGSGAPILLLHGSGPGVTGYANWRLTIPALSADFRVLA
PDAMGFGYTERLEGDVYTLDNWVAHTIGFMDALDIEKASFLGNSFGGALTIAIASRYPER
VDRMALMGAAGLVFDLTESLDKVWGYEPSPGYMGEMMRECFAYDKSIIGDDLVQSRYEAS
VRPGYHESYSAMFPAPRQRHVAALCTPEDKIAALTNRTLLVHGREDLVIPLQSSIRYHHL
IKHSELHVFGECGHWTQIEQKDRFNTLVRNFFLS
NT seq 825 nt   +upstreamnt  +downstreamnt
atcatgagcaatccggaaatcggcaagacgatcaaagcggcggggcgcgacaccaattac
ctcgaagagggcagcggtgctccgattctgctcctgcacggctccggccccggcgtgacc
ggctatgccaattggcggctgaccatcccggccctgtcggcagatttccgcgttctcgca
ccggacgcgatgggattcggctataccgagcggcttgaaggcgacgtttacacgctggac
aactgggtcgcgcatacgattggcttcatggacgcgctcgatattgagaaggccagcttt
ttgggcaattccttcggtggcgcgctgacgatcgccatcgcgtcgcgctatcccgaacgc
gtggaccgtatggccctgatgggtgcggcgggattggtgttcgacctcaccgaaagcctc
gacaaggtctggggatatgagccgagcccgggttacatgggcgagatgatgagggagtgc
ttcgcctacgacaaaagcatcatcggggacgatctggttcagtcccgctacgaggcgagt
gtgcgtccaggctatcacgaaagctattcggcaatgttccctgccccgcgtcagcgccac
gtcgccgctctgtgcacgcccgaagacaagatcgccgccctgaccaaccgcactctgctt
gttcatgggcgagaagatcttgttatcccgctccaatcaagcatccgctaccaccacctg
atcaagcactccgagctgcatgttttcggcgagtgcgggcactggacccagattgaacag
aaggaccgtttcaacacgcttgtgcggaacttctttttatcatga

DBGET integrated database retrieval system