KEGG   Microbacterium oleivorans: BWL13_00678Help
Entry
BWL13_00678       CDS       T05832                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
moo  Microbacterium oleivorans
Pathway
moo00250  Alanine, aspartate and glutamate metabolism
moo00280  Valine, leucine and isoleucine degradation
moo00310  Lysine degradation
moo00410  beta-Alanine metabolism
moo00640  Propanoate metabolism
moo00650  Butanoate metabolism
moo01100  Metabolic pathways
moo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:moo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BWL13_00678 (gabT)
   00650 Butanoate metabolism
    BWL13_00678 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BWL13_00678 (gabT)
   00280 Valine, leucine and isoleucine degradation
    BWL13_00678 (gabT)
   00310 Lysine degradation
    BWL13_00678 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BWL13_00678 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:moo01007]
    BWL13_00678 (gabT)
Enzymes [BR:moo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BWL13_00678 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BWL13_00678 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     BWL13_00678 (gabT)
Amino acid related enzymes [BR:moo01007]
 Aminotransferase (transaminase)
  Class III
   BWL13_00678 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AZS43133
LinkDB All DBs
Position
697145..698545
Genome map
AA seq 466 aa AA seqDB search
MASDRTPPRLYARGMSTSIAPVTTPLGGPSLPQERRLETAIPGPRSQELLARKAEAVAAG
VGHTVPIAAVAAGGGVVVDADGNSLIDLGSGIAVTTVGNAHPKVVEAIAAQAAQLTHTCF
MISPYESYVEVAETLNRLTPGDHAKKSALFNSGAEAVENAVKIARKFTGKQAVVAFDHAY
HGRTNLTMALTAKSMPYKSGFGPFAAEVYRVPASYPFRDGLSGQDAAARAISMIEKQIGA
DNLAAVIIEPIQGEGGFVVPADGFLPAVVEWCRANDVVFIADEVQSGFARTGAMFASEHF
GIVPDLITTAKGIAGGMPLAAVTGRADIMDATHTGGLGGTYGGNPVACAAALAAMDAFEN
DGLVERAQEIETLLTGRLREIAASDPRIGEVRGRGAMIAAEFVDPETGAPDAALTGAVAK
ACIAAGVIVLTCGTYGNVIRFLPPLSIGDDLLAEGLDVLAEALGTV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
ttggcgagtgaccgcacgcccccgcgcctctacgctcgcggcatgagcacctcgatcgca
cccgtgaccacgcccctcggcggaccgtcccttccgcaggaacgccgcctcgagactgcg
atccccggaccgcgctcgcaggaactgctcgctcgcaaggcggaggccgtcgcggcaggc
gtcggtcacaccgtgccgatcgccgcggtcgcagccgggggcggagtcgtggtggatgcc
gacggcaactcgctcatcgacctcgggtccggcatcgccgtcacgacggtgggcaacgct
cacccgaaggtcgtcgaggcgatcgccgcgcaggccgctcagctcacccacacctgcttc
atgatctcgccgtacgagtcgtacgtcgaggtggccgagacgctcaaccggctcaccccc
ggcgaccacgccaagaagagcgccctgttcaactcgggcgccgaagccgtcgagaacgcc
gtcaagatcgcccgcaaattcacgggcaagcaggccgtcgtcgccttcgaccacgcctac
cacggccgcaccaacctcacgatggccctcacggccaagtcgatgccctataagagtggt
ttcggacccttcgcggccgaggtctaccgcgtgcccgcgtcgtacccgttccgcgatggc
ctctccggtcaggatgccgcggcccgcgccatctcgatgatcgagaagcagatcggtgcc
gacaacctggccgccgtcatcatcgaacccatccagggcgagggcggcttcgtcgtcccc
gccgacggcttcctcccggcagtcgtcgagtggtgccgcgccaacgacgtcgtcttcatc
gccgacgaggtgcagtccgggttcgcccgcaccggcgcgatgttcgcgagcgagcacttc
gggatcgtccccgacctgatcaccacggccaagggcatcgcggggggcatgcccttggcc
gcggtcacgggacgcgccgacatcatggacgcgacccacaccggtggcctcggcggcacg
tacggcggcaaccccgtcgcctgcgctgcagcgctcgcggcgatggatgcgttcgagaac
gacggcctcgtcgagcgggctcaggagatcgagaccctactgacggggcgactgcgggaa
atcgcggcatccgacccccgcatcggcgaggtgcgcggtcgcggcgccatgatcgccgcc
gaattcgtcgatccggagacgggagctcccgatgcggcgctcaccggtgcggtcgcgaag
gcgtgcatcgcggcgggcgtcatcgtcctcacgtgcggcacctacggcaacgtcatccgc
ttcctgcccccgctgtcgatcggagacgacctgctggcggaaggcctcgacgtgctcgca
gaggcactggggacggtctga

DBGET integrated database retrieval system