KEGG   Microbacterium oleivorans: BWL13_00685Help
Entry
BWL13_00685       CDS       T05832                                 

Definition
(GenBank) hypothetical protein
Organism
moo  Microbacterium oleivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_19 TPR_16 PPR TPR_2 TPR_14 TPR_6
Motif
Other DBs
NCBI-ProteinID: AZS43140
LinkDB All DBs
Position
complement(706740..709532)
Genome map
AA seq 930 aa AA seqDB search
MTGFATRIRSLFDEIDNTPWGPQEQALVAQAVALAQESGDERLEYEARLRQTSSANMGGD
TDLMLTSFAWCLAHHDADPQRFPAEIDRAGDVLWQYKWMASALGGSPEFPSEQIAAVLDD
MEAHYRRAGVGPSGVLMARFEDAWAAGRMDEATDLQRTLEATPRDDYSHCDACVRSQFAG
FFIETGREDEAIRLVDEMIENGFSCGEEPEHVLSRILLPYLRAGMLDEARTAHLRSYRLA
KDNPDNLAIVAKNIVFCVVTGNEARALALVERHLPWIVHDGLNADAHATALGAFALALDA
VAAAGHPELTVRGSDTEALVPVFGEHEGAWRVDDLAAAAWAAAGSIAAAFDRRNGTDAHT
RNLERLRDTGAERYDVPIRSHDFSTAVPATPAVTREERLDRAVALAQAGSIAAIEPIREL
LTDASPDERVTLSAHLLGGLVAVERTDEAEAFLPERFAALRAAGHVEQADLEERLGLVLF
GKDLATAGDALRAEVAAAESAPAEVRADLIATLAVARMYEGAFAEAREDAREGARLFAEA
GDATRSQGVRLLEVEAAASASQTDEARALVADLLAEPISDGRRARALAARARLHGTAEEF
AEGAADADETVRLLLTLGADDLRVGEAFVLAGALHEDAGSGALAAGRYRSAVERFESAGA
PTADARYRLGRAMITSGMPQEAVDALHEVLQEETAAEVPAGSRAITVGLLARAYEGADDY
GNAVGAWGFAADLHEEAGEVDGQAHALVQQGRHLGNFGEFDDAVTAVETAIGLIRGQEEQ
VGLQAEALHLLAQAKMQRGEEDAFDVIDEALALGRANEAHWYVADVTDTRARLLAARGRT
DEAVATALQAADGFAAAGDAGSGAGSELLAARLLVGAERSADAVALYRSTLDHAAENEQL
RQQAALELGDVYESLGRHAEAAEVRSTLPA
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttttgcgacccgcatccgatccctcttcgacgagatcgacaacacgccgtgg
ggcccgcaggagcaggccctcgtcgcgcaggcggtcgcgctcgcgcaggagagcggcgat
gagcggctcgagtacgaggcgcgcctccgccagacctcgagcgcgaacatgggcggcgac
accgacctcatgctgacctcgttcgcgtggtgcctcgcgcaccacgacgccgacccgcaa
cgcttcccggccgagatcgaccgtgccggcgacgtcctttggcagtacaagtggatggcc
agcgccctcggcgggtcgccggagttcccctcggagcagatcgccgcggtgctcgacgac
atggaggcgcactaccggcgagcgggcgtcggtcccagcggggtgctgatggcacggttc
gaggatgcctgggctgcaggccgcatggacgaggcgaccgacctgcagcgcacactcgaa
gccacgccgcgagacgactacagccactgcgacgcgtgcgtgcgcagtcagttcgccggc
ttcttcatcgagacggggcgcgaggacgaggccatccgcctcgtcgacgagatgatcgag
aacgggttctcgtgcggcgaggaacccgagcacgtgctgtcgcggatcctgctgccctac
ctccgcgccgggatgctcgacgaggcccgtaccgcgcacctgcggagctaccgcctcgcc
aaggacaaccccgacaacctcgcgatcgtcgcgaagaacatcgtgttctgcgtcgtcacc
ggcaatgaggcccgcgccctcgcgctcgtggaacgccacctgccgtggatcgtccacgat
ggcctcaacgccgatgcgcacgcgaccgcgctcggcgctttcgcgctcgccctcgacgcg
gtggccgccgccggccaccccgagctcacggtccgcggctcggatacggaggctctcgtc
cccgtcttcggcgagcacgaaggcgcatggcgcgtcgacgacctcgccgccgcggcatgg
gcggcggcaggatcgatcgccgccgcgttcgaccgtcgaaacgggaccgatgcccacacg
cgcaacctcgagcgcctccgcgacaccggcgccgagcgttacgacgtgccgatccgctcg
cacgatttctcgaccgctgtgccggcgactcccgccgtgacgcgggaggagcgactcgat
cgcgccgtcgctcttgcgcaggcggggtcgatcgccgcgatcgagccgatccgagaactg
ctgacggatgcctcccccgacgagcgtgtgaccctgtcggcacacctgctgggcggtctg
gtcgcggtggagcgcaccgacgaggccgaggcgttcctccccgaacgctttgctgcgctc
cgcgcggcggggcatgtcgaacaggcggacctcgaggagaggctcggcctcgtcctcttc
ggcaaggacctcgccaccgccggcgacgccctccgcgcagaggttgccgccgccgagtcc
gcgcccgccgaggtgcgtgcggacctgatcgcgacactcgccgtcgcgcggatgtacgag
ggcgccttcgcggaggctcgcgaggacgcccgcgaaggagcgcgcctgttcgccgaggcg
ggagacgcgacccgctcgcagggtgtgcggctgctcgaggtggaggcagcggcatccgct
tcgcagaccgatgaggcgcgcgctctggtggcggacctcctcgccgagccgatcagcgac
ggacgtcgcgcccgcgcgttggccgcgcgcgcacgcctccacggcactgccgaggagttc
gcggagggtgcggccgacgccgacgagacggtgcggttgctgctgacgctcggcgcggat
gacctgcgggtcggagaggcgttcgtcctcgcgggagcactccacgaggacgccggctcg
ggcgcgctcgcggcgggacgctatcgctccgccgtcgaacggttcgagtccgcgggggcg
ccgacggccgacgcgcgctaccgactcgggcgcgcgatgatcacgtcggggatgccgcag
gaagcagtggacgccctgcacgaggtgctgcaggaggagaccgccgcagaggtgccggca
ggctcgcgcgccatcaccgtcggactgctcgcacgagcctacgaaggcgcggacgactac
gggaacgccgtgggcgcgtggggcttcgcggccgacctccacgaggaggcgggcgaggtc
gacggtcaggcgcatgccctcgtgcagcagggccgccacctcgggaacttcggcgaattc
gacgatgccgtgaccgccgtcgagacggcgatcggcctcatccgcggacaggaggagcag
gtcggactccaggccgaggcgcttcacctgctcgcgcaggcgaagatgcagcggggcgaa
gaggacgcgttcgacgtcatcgacgaggccctcgccctcggccgggcgaacgaggcgcac
tggtacgtcgccgacgtgaccgacacgcgcgcgcgcctgctcgccgcccgcggccggacg
gacgaggcggtggcgacagcgctgcaggctgcggacggattcgccgccgccggcgacgcc
ggatcaggcgcgggctcggagctcctcgcggcgcgcctgctggtgggcgccgagcgctcg
gccgacgctgtcgcgctctaccgctcgaccctcgaccacgcggcggagaacgaacagctc
cgccagcaggcggcgctggaactcggtgacgtctacgaaagcctcgggcgccacgccgag
gccgcggaggtgcgctcgacgctcccggcctga

DBGET integrated database retrieval system