KEGG   Microbacterium oleivorans: BWL13_00720Help
Entry
BWL13_00720       CDS       T05832                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
moo  Microbacterium oleivorans
Pathway
moo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:moo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BWL13_00720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:moo02000]
    BWL13_00720
Transporters [BR:moo02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BWL13_00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_membrane AAA_29 AAA_33 AAA_16 AAA_22 MMR_HSR1 APS_kinase AAA_18 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AZS43174
LinkDB All DBs
Position
complement(744263..745930)
Genome map
AA seq 555 aa AA seqDB search
MTTTTEILRTSVPPRRRFWPALASGFLSEASAVALLAVSAWLIVRASEQPLVMYVAMAVV
GVRAFALSRAAFRYTERLASHDAVLRQLARTRTDLVRRLLPHAPAGLAASSQGDATAALV
DDIDELQNLPLRVILPLASSATVAVGAVVLVGLVWWPAAVTLLGCLIVAAIAALAWGWAA
GARAERSIAPLRARLRDAVVDHLSRLDVLVASGAEPASRAAVRDADTALRRAVLRRAGAQ
AGTAALASLMAGAATVAALVVAAPAAAGGVLSGPALGVAVLVPMAVFEVYTAVPLAASAW
RQVGAAASRVASVVPAAVPAEIPPTGTPTGEAPALGDGLRLRGVDVRWPGAARPALTGVN
LDVHPGERLHVVGASGAGKSTLAHALVRFLSVTGDYTIGGRPVETIAPDDLRLTIGLCEQ
HPMLFDEDIRQNLLFARDTATDDDLERVLERVGLGDWLRARGGLDARVGERGSLVSGGQA
QRISLARALLRGFPVLILDEPTAGVDPAAADALLTDLLGAVNGSHAVVLISHAEVPAALV
DRTVHVVNGRIGGAA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacgaccgagatcctccgcacctccgtcccgccgcggcggcggttctggccg
gcgctcgcctccgggttcctgtccgaggcctcggcggtggcgcttctcgcggtgagcgcg
tggctcatcgtccgcgcgtcggagcagccgctcgtgatgtacgtcgcgatggcggtcgtc
ggggtccgcgccttcgccctctcccgtgccgccttccggtacaccgagcgtctcgcgagc
cacgacgccgtcctccgccagctcgcccggacccgcaccgacctggtgcgccggctactc
ccgcacgcgcctgccgggttggccgcgtcgtcgcagggcgacgcgacggcggcactcgtc
gacgacatcgacgagctgcagaacctgccgctccgggtgatcctccccctcgcgtcctcc
gcaacggtcgcggtgggagccgtcgtcctcgtgggcctcgtctggtggcccgccgccgtc
acgctgctcggctgcctcatcgtcgccgcgatcgcggcactcgcctggggctgggcggcc
ggagctcgcgccgagcggtccatcgctccgctgcgggcacgcctccgcgacgccgtcgtc
gaccacctgtcccgcctcgacgtactggtggcgtcgggtgccgaacccgcctcccgcgcg
gctgtccgcgacgcggacaccgccctccgccgcgccgtcctccgccgcgccggcgcccag
gcggggaccgctgcgctcgcctccctcatggcgggcgctgccaccgtcgccgcgctcgtc
gtcgccgcaccggccgccgccggcggagttctctccggtcccgcgctcggagtcgccgtc
ctggtcccgatggcggtcttcgaggtttacacggccgtgccgctcgcggcatccgcgtgg
cggcaggtgggcgccgccgcatcccgcgtcgcctccgtcgtaccggcggcggtcccggcc
gagatccccccgacgggcacgccgaccggggaagcgcccgccctgggcgacggcctgcga
ctacgcggagtcgacgtgcgctggcctggtgccgcgcgtcccgctctcaccggcgtgaat
ctcgacgtccaccccggcgagcgcctgcacgtcgtcggtgcgagcggagcgggcaaatca
accctggcgcacgcgctcgtccggttcctgtccgtcaccggcgactacacgatcggcggt
cgccccgtcgagacgatcgcccccgacgatctccgcctcaccatcgggctgtgcgagcag
catccgatgctcttcgacgaggacatccgccagaatctgctcttcgcacgcgacaccgcg
accgacgacgacctcgaacgcgtgctcgagcgggtcgggctgggcgactggctgcgggcc
cgcggcggactcgacgcacgggtcggcgagcgcggttcgctcgtgtcaggcggtcaggcg
cagcgcatctcgctcgcccgcgcgctccttcgcggcttccccgtgctcatcctggacgag
ccgaccgcgggggtcgaccccgccgcggcggacgccctgctcaccgacctgctcggcgcg
gtcaacgggtcgcatgcggtcgtcctcatctcgcacgcggaggtcccggcagccctcgtc
gatcgcacggtgcacgtcgtcaacggccgcatcgggggtgccgcctga

DBGET integrated database retrieval system