KEGG   Microbacterium oleivorans: BWL13_01654Help
Entry
BWL13_01654       CDS       T05832                                 

Gene name
ligD_2
Definition
(GenBank) Multifunctional non-homologous end joining protein LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
moo  Microbacterium oleivorans
Pathway
moo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:moo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BWL13_01654 (ligD_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:moo03400]
    BWL13_01654 (ligD_2)
Enzymes [BR:moo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BWL13_01654 (ligD_2)
DNA repair and recombination proteins [BR:moo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BWL13_01654 (ligD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AZS44071
LinkDB All DBs
Position
1657034..1659385
Genome map
AA seq 783 aa AA seqDB search
MPAAPQEVRIDGRRLRLTNLDKVMYPETGTTKGEVIDYLTRIAPAMLPHLDGRPVTRIRW
PDGTGEGSFFAKHLEAGAPSWVARRPIEHSTGAKDYPLVDGIPALVYLAQVASIELHVPQ
WRFDPDGARGNPDRLVLDLDPGPGAGLAECAEVARWARAILTDLGMDPLPVTSGSKGIHL
YAPLDGSRTSEQISAFAKELARALEADHPDLVVSQMSKAARPDKVFLDWSQNNGKKTTIA
PYSLRGRERPAVAAPRTWAELADPDLRHLLFDEVLARVAADGDLLAPLAPTDAGPLRSYI
AKRSAAKTPEPVPDSPAGAASPGASRFVIQEHHARRLHYDLRLERDGVLVSWAVPRGIPE
SASTNHLAVMTEPHPMEYLDFAGDIPAGEYGAGSMSIWDTGTFELEKWRDDEVIFTATGR
GDGPLGSVRLALIRTSGQGEKSQWLLHRMKTDAATPKTPPAPPSAPRPMLATNSTPSLAR
LAADRWGGWVEFKWDGVRALGVWDGARLHLRARSGTDITARYPELTADPGLGSAPCVIDG
EIVALDERNRPSFPLLQHRMHLTKPAEIQREATRIPVQYLLFDVLEVDGTDASSLPLAQR
RELLERIAADTTDTIVLPPVADDVDDALATAEKLGLEGLVVKDPSSPYRRGERSEQWLKV
KLTLMQEVVIGGIRPGKGGRSGAIGSLLMGVPTDNGLHYVGRVGSGFSDATLARLDAALT
PLRTQENPFVDVGRAEASDALWVKPELVGEVEYAEATPNGTLRHARWRGLRPDKTPSEVR
PGG
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgcgccgcaggaggtccgcatcgacgggcgtcgtcttcggctgacgaacctc
gacaaggtcatgtatcccgagacggggacgaccaaaggcgaggtcatcgactatctgacc
cgcatcgccccggcgatgctgccgcatctcgacggtcggccggtcacccgcatccgctgg
cccgacgggaccggcgagggatcgttcttcgccaagcacctcgaggcgggggcgccgtcg
tgggtggcgcggcgtccgatcgagcattccaccggcgcgaaggactaccccctcgtcgac
gggatccccgcgctcgtctaccttgcgcaggtcgcatcgatcgagctccacgtgccgcag
tggcggttcgaccccgacggcgcgcgcggcaacccggacagactcgtcctcgatctcgac
cccgggccgggtgccggtctcgccgaatgcgccgaggtcgcccgatgggctcgcgcgatc
ctgacggacctgggcatggatccgctgccagtcacgagcggcagcaagggcatccacctc
tatgccccgctggatggttcacgcacgagcgagcagatcagcgcgttcgcgaaagagctc
gcccgcgccctcgaagccgaccaccccgatctggtcgtcagccagatgtccaaagcggcc
aggcccgacaaggtcttcctcgactggagtcagaacaacggcaagaagacgacgatcgcg
ccgtactcgctgcgggggcgcgagcgcccggctgtcgccgcgccccggacgtgggccgaa
ctcgccgatcccgatctccgccacctgctcttcgacgaggtgctcgcccgggtggccgcc
gacggcgacctcctcgccccactcgccccgacggatgccggtccgcttcgctcctacatc
gccaagcgatcggcggcgaagacgcctgaaccggtgcccgactcccccgccggtgcggcc
tcccccggcgcctcccggttcgtgatccaggagcaccacgcacggcgccttcactacgac
ctgcgcctcgaacgcgacggggtgctcgtcagctgggcggtgccccgcggcatccccgag
tcggcttcgacaaaccacctcgccgtcatgaccgagccgcatccgatggagtacctcgac
ttcgccggcgacatccctgccggagagtacggcgcgggttcgatgtcgatctgggacacc
gggacgttcgagctcgagaagtggcgtgacgacgaggtgatcttcaccgcaaccggacgc
ggcgacggtccgctcggctcggtgcgactcgcgctcatccgtacgagcggccagggcgag
aagtcgcagtggctgttgcaccggatgaagacggatgccgcgactccgaagacaccgcct
gcgccgccctcggcgcctcgtcccatgctcgcgacgaactcgacgccgtcgctcgcgcgg
ctggcggcggatcgctggggcgggtgggtcgagttcaaatgggacggggttcgcgccctc
ggcgtctgggacggcgcacgtctgcacctgcgtgcccgaagcggcacggacatcaccgcg
cgttaccccgagctgaccgcggatccgggcctcggctccgcgccctgcgtgatcgacggc
gagatcgtcgcgctcgacgagcggaaccgcccgagcttcccgcttctccaacatcgcatg
cacctcacgaagcccgcggagatccagcgcgaagcgacgcgcatcccggtgcaatacctg
ttgttcgacgtgctcgaggtcgatgggacggatgcctcttcacttcccctcgcgcagcgt
cgggagcttctcgaacggatcgccgccgacacgaccgacacgatcgtcctcccccctgtc
gcggacgacgtcgacgatgccctcgcgacagccgagaagctgggtctggagggcctcgtc
gtgaaggatccgtcctcgccctatcgccgcggcgaacgcagtgagcaatggctgaaggtg
aagctcaccctcatgcaggaggtcgtgatcggcggcatccgtcccggcaaaggcggccgg
agcggtgcgatcggctcccttctcatgggcgtcccgacggacaacgggctgcactacgtc
ggccgcgtcggctccggcttcagcgacgcgacgttggcgcgattggatgccgcactcacc
cccctccgcacccaggagaacccgttcgtcgacgtcggccgggccgaggcatccgatgcg
ctctgggtgaagccggagctggtgggagaggtcgaatacgcggaggcaacgccgaacggg
accctccgacatgcgcgctggcgcgggctgaggccggacaagacgccgtcggaagtgcgc
ccgggcggctga

DBGET integrated database retrieval system