KEGG   Mesorhizobium opportunistum: Mesop_1102Help
Entry
Mesop_1102        CDS       T01542                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00500  Starch and sucrose metabolism
mop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mesop_1102
Enzymes [BR:mop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Mesop_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Prenyltrans
Motif
Other DBs
NCBI-ProteinID: AEH85587
UniProt: F7YD52
LinkDB All DBs
Position
complement(1142438..1144855)
Genome map
AA seq 805 aa AA seqDB search
MPVTPKNAPGAPGIPARWTSSAKSGVGTSLSPTGQIWFTISHGILNEVYYPRLDSACTRD
LGLLVTGPDGYFSEEKRDAAHTIEPFEDGVPAYRLVNTATDGAYRIEKRILADPARAALL
QEITFTPLKGTAGDYRIYALLAPHLVNAGIGNTAWIGAHDGKSMLFASGRGSCLALASSL
PWRDCSTGYVGFSDGWQQLTHAGKLDPACQRAENGNVALTGEIGFTSARTRAVLALGFGA
TPDEAAENAFASLKRGFEPAAKSYVQNWRKWQAGLLPLDRHAASGVNSYRTSTAVLATHR
SITEPGAAVASLSIPWGFDKGDDDLGGYHLVWPRDLVETAGGFLAAGDAASALQILDYLS
SIQQPDGHWPQNAWLDGSAYWPGIQMDECAFPLLLADALHRAGHLPRTRLATFQPMIERA
ATYVVRNGPVTGEDRWEEDAGYSPFTLAVEIAALLAAADLLDACGKADAATYLRETADVW
NDQVERWTYVTATATCEVAGVDGYYVRISPPDSAEAGSPKDGFVPIKNRPPGDTDRPAQE
IVSPDALALVRFGLRAADDPRIVDTVKVIDAQLRCALPQGPLWYRYNGDGYGEHEDGSPF
DGTGQGRPWPLLAGERAHYELAAGRKDKAAGLLDTLERSAGTGGLLPEQVWDGVDMPERE
LLRGRPSGSAMPLVWAHSEHIKLLRSLRDGAVFDMPPQGVKRYIEDRTVSPFRTWRFNNK
IRALPGGKTLRVELLAPATVHWSIDNWTTAQDSKTEENAFGIHLVDLPVADLPSGSTLTF
TFFWPGNGDWENVDFSVTSGEQDSR
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgacgccaaaaaatgccccgggcgccccgggaattccggcgcgctggacgtca
agcgccaagagtggcgtcggcacttcgctttcgccgaccggtcagatctggttcaccatc
agccacggcatcctcaacgaagtctactacccgcggctcgacagcgcctgcacccgcgac
ctcggcctgctcgtcaccggtcccgacggctacttctcggaagaaaagcgcgatgccgcg
cataccatcgagccgttcgaggacggcgtgccggcctacaggctggtcaacaccgccacc
gatggcgcctaccgcatcgaaaagcgcatccttgccgacccggcacgcgccgcactgctg
caggaaattaccttcacgccgctcaagggcacggctggcgactaccgcatctacgccttg
ctggcgccgcatctggtcaatgccggcataggcaacaccgcctggatcggcgcccacgac
ggaaaatccatgctgttcgcctcggggcgcggctcttgtctggcattggcttcgtcgctg
ccctggcgagactgttcgactggctatgtcggcttctccgacggctggcagcaactgacc
catgccggcaagctcgatccagcctgccagcgcgccgagaacggcaatgtcgcgctgacc
ggcgagataggcttcacatcggccaggacaagggccgtgctggcgctgggttttggcgcg
acaccggatgaggccgcggaaaacgccttcgccagcctgaagcggggcttcgagcctgcc
gcgaaatcctacgtccagaactggcgcaaatggcaggccgggctgctgcctctggatcgg
cacgcggcgtctggggtcaacagctatcgaaccagcaccgctgtcctggcgacgcaccgc
tcgatcacggagccgggcgcggcggtcgccagcctgtccatcccctggggcttcgacaag
ggtgacgacgacctcggcggctaccatctggtctggccgcgcgaccttgtcgagacggcg
ggcggatttctcgcggcaggcgatgccgcctcggcgctgcagatcctcgattatctcagc
tccatccagcagccggacggtcattggccgcagaacgcctggctcgacggatccgcctat
tggccaggcatccagatggacgaatgcgcctttccgctgctgctggccgatgccttgcac
cgcgccgggcacctgccacgtaccaggctcgccaccttccagccgatgatcgagcgcgcc
gcaacctatgtcgtgcgcaacggacccgtgaccggcgaggaccgctgggaagaggacgcc
ggctacagcccgttcacgctcgccgtcgagatcgccgcattgcttgccgccgccgacctg
ctcgacgcctgcggcaaggcggacgcggcaacctatctgcgcgagaccgcggacgtctgg
aacgaccaggtcgagcgctggacctatgtcaccgccacggccacctgcgaggtggccggc
gtcgacggctactatgtccgcatctcgccgcccgacagcgccgaggccggctcgccgaag
gatggctttgtcccgatcaagaaccggccacctggcgacaccgatcggccggcgcaagag
atcgtcagcccggatgcgctggcgctggtccgctttggcctccgggccgccgacgatccg
cgcatcgtcgacaccgtcaaggtcatcgacgcgcaattgcgctgcgcattgccgcaaggg
ccgctctggtaccgctacaatggcgacggctatggcgagcacgaggacggctcgcccttc
gacggcaccggccaaggccggccgtggccgctgctcgccggtgagcgcgcccattacgaa
ctggcggcaggtcgcaaggacaaggccgccggcttgctcgacacgctggaacgatccgcc
ggaaccggcggcctgttgccggaacaggtctgggacggcgtcgacatgcccgagcgcgaa
ctgttgcgcggcaggccatcgggcagcgccatgccgctggtctgggcccattcggagcac
atcaagctgttgcgctcgctgcgcgacggcgcggtcttcgacatgccgccgcaaggcgtg
aagcgctacatcgaggacaggaccgtatcgccgttcaggacatggcgcttcaacaacaag
atccgtgcgctgcctgggggcaagacgttgcgcgtcgagctgctggctccggccacggtg
cattggagcatcgacaactggacgaccgcccaggacagcaagaccgaagagaatgctttc
ggcatccaccttgtcgatctgcccgtcgccgacctccccagcggaagcacgctgaccttc
acttttttctggcccgggaacggcgattgggagaatgtcgacttctccgtcacatcgggc
gagcaggatagccgctaa

DBGET integrated database retrieval system